SSO6198

Coordinates:511318-511452

>SSO6198 45 aa !not a gene!
MFSISISSLSELGNIVYIVFPSISLIFTIPSLLSFLITKYDFFIK

>SSO6198 45 aa !not a gene!
TTGTTTTCAATTTCTATCTCATCACTATCAGAGCTAGGTAATATTGTGTATATTGTTTTCCCGTCTATATCACTTATTTT
TACCATTCCTTCCTTACTCTCATTTCTTATCACAAAATACGACTTTTTCATTAAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 510818 - 511952 (Additional range around SSO6198 is :500nt.)

>Sulfolobus solfataricus P2 TTATTCCTTTCACTATTCTTTCCATAATTCAAAAGGAGACAATAGAAGGAGCCTCTAAAGCTAGAACATATCTAAAAATA TCAGCAATTTCAGGAATAATCGCGTTTTTACTAGGGAGTCTTCCATTCTTTAAAGGCTAATCTGTTTATCTATTATCTTT CTATATCCTCCCTTTACCCCAACTACTCTTACGTTGATTATTGGAGCTTTCTTACTTTGTGGTACGGATATGGGCAATTT TAGGTCTATAGTCGAGGAAACATCTATATTGGTAAATGTTTTAAAATGGGCCGGAACACCATTTATCATAACGTTTATTA GTAGTTTATCTAAACTTATCTCGCTCTCATTTTTCAAGTATAGGTAAATTATGTTATCACTCACCTTACTGTCTACGCTA AAATTTATTTTAGGAGCTTTTTCAAGTAAGTTATACGAAGCTAAAATAACTCCATAGTCTTTTTCATTATTTGATTGAAG CGTAGTCGTTATCGCATCA TTGTTTTCAATTTCTATCTCATCACTATCAGAGCTAGGTAATATTGTGTATATTGTTTTC CCGTCTATATCACTTATTTTTACCATTCCTTCCTTACTCTCATTTCTTATCACAAAATACGACTTTTTCATTAAG TGAA AAGAAACTGAATCATTTCTATTGAAAATTAGTGATCCGGCACTCAGTCGATATTTAGTACTAAAACCTTCTGTTCTATAG AACGAAATCAGACTTATGTTAAGTAACTCAAGTACTTGAATAGATGGATGGTATACTGCTATTTGATGTTTCCCTTCTTT GATTATAGGAGTTATATCATAGACTATAGTTGAGATAACTTGGGCATCATTTATTTCAGTTTCGAGATTTGGTTTAAATT CTTTTGTAAGAGAGAAATTATCAAACCAAAGCCTCCATCTAGGCAAATATGTTTTTTCTCGTTTAGCTTGGATTATAAGA TAAAACTTAGTAGGCTTCGATGCTATATCTATAGAGAAACTAGCCTCTTTATTTATGTTACTTAGCTTAATCGATTTCGT AAAGGACTGATAGTCTATTGACCCTTCAAAGTCTCCTTCGTCAAATATCGCTAACTCTCCTTTAGGCATGCATAAAAATA GTAATTACAAGAAAAT