SSO6213

Coordinates:518400-518564

>SSO6213 55 aa !not a gene!
MTLYLQQFSSCIHVPIALVRPSLNLQPLANLHLLYTFFVLRFRAIFPQLNAEQMV

>SSO6213 55 aa !not a gene!
TTGACCTTATATCTTCAACAATTCTCTTCATGTATTCATGTTCCAATAGCGTTAGTTCGTCCATCTTTGAACCTTCAACC
TCTGGCCAACCTTCATTTACTATATACGTTTTTTGTTTTAAGATTTCGTGCCATATTTCCTCAGCTAAATGCGGAGCAAA
TGGTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 517900 - 519064 (Additional range around SSO6213 is :500nt.)

>Sulfolobus solfataricus P2 GATTAGAGATTTAGTAAATATAATTTCAAAAAAATATGAGACAAATAGAGATAATGTTAGAGTTGAACTAGCATTTCTTA AAGAGTTAGGTATAATAGAAGTTAAAGATCGAAAAGTTATTCTTACTCAATTATTATAGCAGGTCTTAAGGGCATGGCTT CTTTATTATATGTCTTTTTGACTTCTTCATCATAAGGCTCTATAAGAATGTCTACATTTAACTTTCTCCTAATATATTTT GATAATTTATTGAGTACATCTACCTCATTAATATTATAGTTTGTAACTAATTTCTTCATCTTATCGTCAATTTCTAAGGA TTCATTAAAGATTTTCTGTAAAATTCTAGCATCTTCTCTACTCTTAGGTTTATGAATGTCCATAAACTTTTTCATTTGTC CATTAGCTACTATAGCATCCCTAAGCAATTCCATATATCTAGAATCGTTCAAAGCGTAAATTTTAATGAGTTTCGGTGTT CCCTTAAAAATGTTTAGGA TTGACCTTATATCTTCAACAATTCTCTTCATGTATTCATGTTCCAATAGCGTTAGTTCGT CCATCTTTGAACCTTCAACCTCTGGCCAACCTTCATTTACTATATACGTTTTTTGTTTTAAGATTTCGTGCCATATTTCC TCAGCTAAATGCGGAGCAAATGGTG TAATAAGCTTAAGCCATATTGTTAAAACTTCCCGTAAAACTTTATTATTCGCCT CTCTTCCCTCAGCACTTACCATGCCGAAATACTCATCCAAATCTGAAGAGAATACAAATAGTAACTCGTTGACTGCATCC CTCAGTTCTAACGCTTCCATATGTCTGGTTGTACTACTTGTGATCTCATATATTCTTGATAATAACCATTTCTCTGGGAA TCCCAAGATATCTCCAGTATAATTATCTAAGCTCTTGAAAAGTTCATACATTTTTCTTAAGGTTTCTCCTACGGTTTTTA CTAAAGATTCAGAGAAGTTCACATCTGATCCCATATCAGCTGTAGACGAAACGGCAATTCGCATTACGTCAACCCCATAC ATTTTTAGACCTTTTCTTAACGGTATAATGTTCCTAAGTGACTTGCTCATCTTCTTTCCTTCATATAAGACTAAACCATT TACAGCAATTGCTTTTGGCCATAAGTTCTCCTGGAAGATCGCTGCG