SSO6232

Coordinates:527476-527604

>SSO6232 43 aa !not a gene!
MYVAPSIIFSIHISYLHSESLPIRTIATTYHFSKFGLSWHPYL

>SSO6232 43 aa !not a gene!
ATGTACGTAGCCCCTTCTATTATTTTTTCTATCCACATATCTTATCTTCATTCTGAAAGCTTGCCAATCCGTACAATTGC
TACAACTTACCATTTCTCTAAATTTGGCCTGAGCTGGCATCCATACCTC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 526976 - 528104 (Additional range around SSO6232 is :500nt.)

>Sulfolobus solfataricus P2 CAGAAGATGATGTGTACAGAACAATAGAATTAGTAGATAATTTGAGACCATATAGAAGTATATTAGTTCCTATGTTCTTT GTACCTATGGGCTTTTTCAAAAATAGAGATTGGTTCACTAGAGTTAAGTTAAGTGAGGCCCATATAGAGTTATACAGAAA AGTATTCTGGCACGACGTATATTGGGCTGAGGATATTATAAATTCCTTCTACATGAAAGGACCAGTGTATATGCCAGTAA GATTCGCACTGAAGCTATTCTTAAGATTCGCAAAGAAGAAAATGAGAGAAGTAGAAAAATGGTTGGAGAATCAATTAAAA GCATAAAACTAAATTATCTTATTTTTTAGCGGGTATATATAATCTTTAGGAGCCTTCGGAAACGCCTCAAGATATTTTCT TAGTACTTTTGGTACCTCGACAACACCATCTTCTCTCTGATAATTTTCTAGAATAGCTGTTATAGTTCTTGTGCTAGCTA TTGCAGTACTATTTAATGT ATGTACGTAGCCCCTTCTATTATTTTTTCTATCCACATATCTTATCTTCATTCTGAAAGC TTGCCAATCCGTACAATTGCTACAACTTACCATTTCTCTAAATTTGGCCTGAGCTGGCATCCATACCTC TAAATCGAAT TTCTTTGCAGCGCATGCACCTAAATCACCTGACGCTATATTTACAATTCTGTATGGCAATTCGAGTTGCTGAAATATACT TTCAGCATTCGTTATCAATTCACTATGATATTTCCAACTATCTTCTGGAGTTGAAAATATAAACTGTTCAACTTTATGAA ATTGATGAACTCTGAAAATTCCCTTTAAATCCTTATTTGCAGCACTTGCTTCTTTTCTAAAAGCTGGACTAATTCCGGCG AATTTTAAGGGTAATTTATCTTTCTCAATTTCTTCTTTAAAGAACATAGCTGCTATAGGGTGTTCTGCGGTTGCAATCAG ATATAAATCCTCGTTTTCTATCTTATATATAGCATCCTTAAACGTGTCTAGGTCTATTACTGATTGTATAACCTCTCCCC TTAGCATATAAGGAGGGAGAACTAAAGTATACCCTTGCTGAGTAATGTAATCGATTGCGAAAAGTAGTAGAGAGAAGTCT AGCCAAACTA