SSO6253

Coordinates:536556-536753

>SSO6253 66 aa !not a gene!
MNELAKDNLSTMLFIMYPISASLKSTIISSTSKPIKSSLVLSTPRSKTKGKPTFIPYNSFSISLRT

>SSO6253 66 aa !not a gene!
ATGAACGAGTTGGCGAAAGATAATCTTTCAACTATGCTTTTCATTATGTATCCGATATCTGCAAGCTTAAAATCAACAAT
AATTTCCTCCACGTCTAAACCAATTAAGAGCTCTCTAGTTTTATCCACTCCTAGATCTAAAACTAAAGGTAAACCAACTT
TTATCCCATATAACTCATTTTCCATCTCTTTAAGAACT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 536056 - 537253 (Additional range around SSO6253 is :500nt.)

>Sulfolobus solfataricus P2 GGAATTACGCCATATTCCTCGTGTAGATTTTCCCCTATTAATGTTAGTTTATAAAGACCGGCTATTTTTTCACTAATTTC ATTTTTTCCTAAAAATTGCTCCTTTACATTTCATCACCTTATCCTCGATAATCTTATTTATAGTTCTTAATGCTGTTAAT GGATTCCCTGCATTATAAATACTTCTTCCAATGATTTCATAATCCGCTCCAGCACATACTGCATCGCCATAACTTCCACC TTGACTACCCATACCCGGAGAGACTATGGTCATTTTTTCGAAGTCTCTCCTATACTGCGTTATATGATCTAATTTAGTCC CTCCAACTACTATTCCTTTTGGGCTTATCTCTCTTATAACGTTTTTAATATAGTCTGCGAATAACGTACTCCATCCTTCA TGTGACATTACGGCAACTAAGTATAAATTTTTAGAGTTTGCATCAAGATATCTTTTTAATTCATCTAGAGATCCCTTAAC GCCTATAAAGGAATGTGCT ATGAACGAGTTGGCGAAAGATAATCTTTCAACTATGCTTTTCATTATGTATCCGATATCT GCAAGCTTAAAATCAACAATAATTTCCTCCACGTCTAAACCAATTAAGAGCTCTCTAGTTTTATCCACTCCTAGATCTAA AACTAAAGGTAAACCAACTTTTATCCCATATAACTCATTTTCCATCTCTTTAAGAACT TGATATGAGAGAGGTTTATCC ATTGCTAATATTACTCTACTTTTCAACATTCTTCACCAAATAATCTAGAATTGACTTCTTTTCATTATCCTTAAGTTTAT CACTCTTCAACAATTCATCTAGAATTTCTGAAATTTTAAATAGAGAGTGTAATTTGACTCCTAGTTTTTCCAATCTTTGT GAAGCCCCTTCTTGTCTATCTATGATTACTAGTGCGTCTGAAACTTTACCTCCACCGTTAAGAATCTCCAATGTTGCTTT CTCTATGGATACTCCTGTAGTTGCAACGTCATCTACTAACAATACTCTTTTTCCTTTTACATCGAGTTCTAATGTACGAT TAGTTCCATGACCTTTCTTTTCTATTCTAATATATCCCATAGGCTCTTTAAGGTTACAAGCTATGAATGCCGATAAGGGA ACTCCTCCAGTGGCTATTCCTACTATTATATCATGGGGTATATCTTTTGCTTTCTTTATAGCTTGATTAACTATATCGT