SSO6279

Coordinates:549227-549442

>SSO6279 72 aa !not a gene!
MLAPNTDIPSFLKMSAIPLNKGSSGPITPKSGFTFLITSLITSGEFTLPIKYSAPVVFTIELIPGFIYDDSA

>SSO6279 72 aa !not a gene!
TTGCTAGCCCCGAATACCGATATTCCCTCTTTTCTAAAAATGTCCGCAATTCCGTTGAATAAGGGATCTTCTGGTCCAAT
TACGCCTAAATCTGGGTTTACTTTCTTAATTACCTCCTTAATAACTTCTGGGGAGTTTACGTTACCTATAAAATACTCTG
CACCAGTGGTTTTCACTATTGAATTAATCCCGGGATTTATATATGACGATAGTGCG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 548727 - 549942 (Additional range around SSO6279 is :500nt.)

>Sulfolobus solfataricus P2 ATCATAAGTTGTTTGATACTCTTCATTGCTGATAAATGGAAGCAATTCGTTAGGTCCAGAAATTGATCCCATTCCTCCAG TCTCTGGACCTATTCCGTCTTGATACGCGTTCTTATAATCTTGAGCCAAAGGTAAGGAGATAGTTGTTTTCCCATCACTT AAAACATGAAGTGTGTATTCTGGTCCATCAACTTTCTCCTCTATTATAATTCTCGGCTCACCTTCCTTATTGTATAGACT CCCTATTTCATTCACGCTTTTTGTCAGTGCCTCTCTCTTATCATGGGTTAAATAAGCCTCTAGATCAGCTATTACCTTAA CCCCTTTTCCTCCAGCTTGCCCAGCAGGTTTTATTGCGACTGATCCGCCATATTCTAATATGAACTTTGCAGTATCTTCT ATTGTGTAAAATACCTTATATCTTAATCTTCCTGGAATAGAATGTTTCCACATTAACTCTCTTGCCCATGCCTTAGACTC CTCTATCCTTGCACACTTT TTGCTAGCCCCGAATACCGATATTCCCTCTTTTCTAAAAATGTCCGCAATTCCGTTGAAT AAGGGATCTTCTGGTCCAATTACGCCTAAATCTGGGTTTACTTTCTTAATTACCTCCTTAATAACTTCTGGGGAGTTTAC GTTACCTATAAAATACTCTGCACCAGTGGTTTTCACTATTGAATTAATCCCGGGATTTATATATGACGATAGTGCG TAA ATCTTGTAACCTTTAGATGATCTTGCCAACGAATAGGCTAGAACGTTTTCTCTAGCTCCATCTCCAACGAGTAATACTTT CATTTTTCTCACCATGGATATTTTTTAGTCATACATCCTAAGCAGAGATCCCTATGCCCAATGGCTTTGAACAATCCTTC TATGCTTAACCAGTGTATAGAGTCTGCACCTAAAACCCTCGCTATAGTTTCGTCGTTAAGATTAGCTGAGATCAATTCTT TTTCGTCGGGGACTTCAACTCCGTACGGACATTGTGAGACTAATTTAGGGCTTCCTATCAGCACGTGGATTTCCTTTGCG CCCAATTTTCTCAAGTTAAATATAGTGTTTTTAAGGGTAGTTCCGGTGACCATAGAATCATCTATTAGAATTATTCTCTT TCCTTTTACTGCACTTTTTATTGGGTTTAGCTTAAGTTGGACCCCAACTATTTTTAGGAAAGCATCAGAAGATAACATTG TCCTTATTGGGCTCCCT