SSO6281

Coordinates:549879-550013

>SSO6281 45 aa !not a gene!
MSCNNSYVSLSSLLVYRIHSPFNYIISCLILFIADKWKQFVRSRN

>SSO6281 45 aa !not a gene!
TTGTCCTGCAATAACTCCTACGTATCTCTCTCCAGTCTCCTTGTATATCGCATCCATAGTCCTTTTAACTATATCATAAG
TTGTTTGATACTCTTCATTGCTGATAAATGGAAGCAATTCGTTAGGTCCAGAAAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 549379 - 550513 (Additional range around SSO6281 is :500nt.)

>Sulfolobus solfataricus P2 TATAAGAATATCTTATGATTTCAGCCTTTTCAATTTGAGATTTAACTGTCCTCCCAATATCAGTCCTATATATCAATTTA GTATCACTGCTAATATATTGCATACATCTGTCTAAGTTCTCAGCAGCTTCTTCGAAATCTCCTATTGCAACTATTTCTAA AGCTCTAGAGCCTTTAGTTATAAGTTGCATTCCCTCTAATGCTACAGATCCAAAAAATACCACGCATCCGCGCTCTTTCA TCTTTTCTAAATCTACTACAATCTTATGCCCAGATGCCATTTGTTTTGAGATAGGGTATCCTAATGTAGCAACAGCTCTG ACTATAGAAGGTTTCTCGTTTATTTTTATACTAGCTTTATTCAAATGTCCAGTAGCTGTGAGCTCAATTGTCTCTCCAAA ATCAGATTCTAATCTTGGAATTATGGCGGAAGCTTCTGGATCACCAAATCTTGAATAATACTCAATTACTGTAGGTCCCC AAAGTTCAGTTAACATCAT TTGTCCTGCAATAACTCCTACGTATCTCTCTCCAGTCTCCTTGTATATCGCATCCATAGT CCTTTTAACTATATCATAAGTTGTTTGATACTCTTCATTGCTGATAAATGGAAGCAATTCGTTAGGTCCAGAAAT TGAT CCCATTCCTCCAGTCTCTGGACCTATTCCGTCTTGATACGCGTTCTTATAATCTTGAGCCAAAGGTAAGGAGATAGTTGT TTTCCCATCACTTAAAACATGAAGTGTGTATTCTGGTCCATCAACTTTCTCCTCTATTATAATTCTCGGCTCACCTTCCT TATTGTATAGACTCCCTATTTCATTCACGCTTTTTGTCAGTGCCTCTCTCTTATCATGGGTTAAATAAGCCTCTAGATCA GCTATTACCTTAACCCCTTTTCCTCCAGCTTGCCCAGCAGGTTTTATTGCGACTGATCCGCCATATTCTAATATGAACTT TGCAGTATCTTCTATTGTGTAAAATACCTTATATCTTAATCTTCCTGGAATAGAATGTTTCCACATTAACTCTCTTGCCC ATGCCTTAGACTCCTCTATCCTTGCACACTTTTTGCTAGCCCCGAATACCGATATTCCCTCTTTTCTAAAAATGTCCGCA ATTCCGTTGAATAAGG