SSO6285

Coordinates:552150-552284

>SSO6285 45 aa !not a gene!
MRKVVSVRLREDILRDVDMYTRKLGLNSRTEFIKQAIEFYIKNKG

>SSO6285 45 aa !not a gene!
ATGCGAAAAGTCGTAAGTGTAAGACTAAGGGAAGATATACTGAGGGATGTCGATATGTATACTAGAAAACTTGGCCTAAA
TAGTAGAACTGAGTTCATAAAACAAGCAATAGAATTCTATATAAAGAATAAGGGC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 551650 - 552784 (Additional range around SSO6285 is :500nt.)

>Sulfolobus solfataricus P2 ATACTAGGTGGAAGCGACTATCTAATAGAAGCATTAGAAGAGTACTTAGTGAAAGGAGAAGGACCTGCTACAGTAGCCTA TAAATATAATATTTCAAAACATCAACTCCGTGGCTATGCCCAGAGGATTATCGAAAAAAGCGGAAGTGAAGGAAAGGCTA AGAAACTCGTACCAATACTTAAAGCTATCTCAGAGGGAATCACACCAATAGTCAAAAAGGAAAATGACGGATCATATGAG TGTTCACTGTGTAATATTATCATAGCTAAAGAAGATAGTGAAGAGCATATTAGAAAGTACCACAAAGAGATTCTCAATGA AAATATAAATATTATGATGCAAAGACTAGAGAAAATAAAGAAGGATCTGCAACAAAATAAAGCCGTAATATTTACTTCTG CAAGTTAATGATTTTTTACGTACTATTCGACCTCTTTTTAACAGTTTCCTATTAAGAATTATCACTTAGGTTTTTAAAAA CCGGTAACATTCTATTATAT ATGCGAAAAGTCGTAAGTGTAAGACTAAGGGAAGATATACTGAGGGATGTCGATATGTA TACTAGAAAACTTGGCCTAAATAGTAGAACTGAGTTCATAAAACAAGCAATAGAATTCTATATAAAGAATAAGGGC TAA AGGAAACCTTTAACATGCTATTTATCAAGAATCCCTTGTTTTCATGATATCAATTGTTTTTAAGCTTCTTCTTTACCCTT TTTGTGAAATGAAAATAGTCCTTGCATACTCTGGTGGACTTGATACTACAGTATCGATTAGATGGCTAAAGGAAACCTTT AAGGCTGAGATTATAACAGTTACTGTAGATGTTGGTCAAAAGGACGATTTTAAGAAAATAGAAGAAAGAGCGTATATAGC CGGCGCCTCAAAGCATTATACAATAGACGCTGTTAGGCAATTTGCCAACAATTACATAGCATATGCGATAAAATTAAATG GATTATATGAAGGAGTCTATCCGTTGTCAACGGCATTGGCAAGACCATTAATAGCAGAAAAAGTAGTTGAAGTTGCAAAA AAGGAAGGAGCTGAAGCCGTAGCTCACGGTTCTACATCTAAGGGAAATGATCAAGTGAGATTTGACCTTGCAGTTAAGGC ATTATACCCTGACGTT