SSO6286

Coordinates:552104-552247

>SSO6286 48 aa !not a gene!
MNSVLLFRPSFLVYISTSLSISSLSLTLTTFRIYNRMLPVFKNLSDNS

>SSO6286 48 aa !not a gene!
ATGAACTCAGTTCTACTATTTAGGCCAAGTTTTCTAGTATACATATCGACATCCCTCAGTATATCTTCCCTTAGTCTTAC
ACTTACGACTTTTCGCATATATAATAGAATGTTACCGGTTTTTAAAAACCTAAGTGATAATTCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 551604 - 552747 (Additional range around SSO6286 is :500nt.)

>Sulfolobus solfataricus P2 CTCACTTGATCATTTCCCTTAGATGTAGAACCGTGAGCTACGGCTTCAGCTCCTTCCTTTTTTGCAACTTCAACTACTTT TTCTGCTATTAATGGTCTTGCCAATGCCGTTGACAACGGATAGACTCCTTCATATAATCCATTTAATTTTATCGCATATG CTATGTAATTGTTGGCAAATTGCCTAACAGCGTCTATTGTATAATGCTTTGAGGCGCCGGCTATATACGCTCTTTCTTCT ATTTTCTTAAAATCGTCCTTTTGACCAACATCTACAGTAACTGTTATAATCTCAGCCTTAAAGGTTTCCTTTAGCCATCT AATCGATACTGTAGTATCAAGTCCACCAGAGTATGCAAGGACTATTTTCATTTCACAAAAAGGGTAAAGAAGAAGCTTAA AAACAATTGATATCATGAAAACAAGGGATTCTTGATAAATAGCATGTTAAAGGTTTCCTTTAGCCCTTATTCTTTATATA GAATTCTATTGCTTGTTTT ATGAACTCAGTTCTACTATTTAGGCCAAGTTTTCTAGTATACATATCGACATCCCTCAGT ATATCTTCCCTTAGTCTTACACTTACGACTTTTCGCATATATAATAGAATGTTACCGGTTTTTAAAAACCTAAGTGATAA TTCT TAATAGGAAACTGTTAAAAAGAGGTCGAATAGTACGTAAAAAATCATTAACTTGCAGAAGTAAATATTACGGCTT TATTTTGTTGCAGATCCTTCTTTATTTTCTCTAGTCTTTGCATCATAATATTTATATTTTCATTGAGAATCTCTTTGTGG TACTTTCTAATATGCTCTTCACTATCTTCTTTAGCTATGATAATATTACACAGTGAACACTCATATGATCCGTCATTTTC CTTTTTGACTATTGGTGTGATTCCCTCTGAGATAGCTTTAAGTATTGGTACGAGTTTCTTAGCCTTTCCTTCACTTCCGC TTTTTTCGATAATCCTCTGGGCATAGCCACGGAGTTGATGTTTTGAAATATTATATTTATAGGCTACTGTAGCAGGTCCT TCTCCTTTCACTAAGTACTCTTCTAATGCTTCTATTAGATAGTCGCTTCCACCTAGTATCTTTAAAGCTACATAATTTAC TAAAGACTTTATATCAGTTTGTTTC