SSO6295

Coordinates:557375-557542

>SSO6295 56 aa !not a gene!
MSISFTTGIVLVSYLIFLTYSVDLFSALDICSSLNPNFLASFNVSLSISFNFLRVS

>SSO6295 56 aa !not a gene!
GTGTCTATAAGCTTTACCACTGGTATTGTGTTGGTTTCGTATCTAATTTTTCTCACGTATTCAGTAGACTTATTTAGCGC
TTTAGATATCTGCTCATCGCTAAATCCCAATTTCTTAGCGAGTTTTAATGTTTCCTTATCGATCTCTTTCAATTTTCTGA
GAGTTTCG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 556875 - 558042 (Additional range around SSO6295 is :500nt.)

>Sulfolobus solfataricus P2 TGAAGTTGCAGATATCCAATCCGGCTGCGAAATACCTAACTTATCTAATAGTTTTGAGAACTTTTCCCTATTTTCTGCGA TATCTACACTGCTACCCGATGTTCCTAATAACCTTACTCCATTTTCCTCCAACTCTTTAGCTATTGAATTGCCTATTTGT CCACCTGAAAACGTGGCAACATATCTAAACTTCTCCTTCTTAATTAAATCCAATACTCTTTCCACGCTAATTTCGTCAAA ATAAAGCTTCCTCGCAATATCCCAATCAGTTGAGACAGTTTCCGGATTATAATTAAGTACTGCTACTTCATCAAAGTACT TTGATCCTGCTTCCATTAGAGATACAACACTCCAATCAAACTCAACTGAAACTCCTATTCTAAAACCTCCTGCACCAATT ATTAGTAATTTGTTCCCCTGTGAGAATTCTATATCATCTTCCGTACCATTATATGTTAAATACATGTAATTAGTAACTGC AGGCCATTCGCCAGCTAAC GTGTCTATAAGCTTTACCACTGGTATTGTGTTGGTTTCGTATCTAATTTTTCTCACGTAT TCAGTAGACTTATTTAGCGCTTTAGATATCTGCTCATCGCTAAATCCCAATTTCTTAGCGAGTTTTAATGTTTCCTTATC GATCTCTTTCAATTTTCTGAGAGTTTCG TAGAAATCTACTAATCCTTTGATTTTATTTAAAAAGAACTCGTTAATTCCA GTAACCTCATATACTTCATTAATTGTTGCTCCCTCTTTGAAGGCTTTAGCTGCGTATAAGAACCAGTATGGTCTTCTTTC TTTGAGGTACTTTAGCGCTTCTTCTTTACTCATATTGGACTCATATACCTTTCCACCTACGACCCCAGGTTCACCAATAT CTAGCATCCTTATAGCTTTCTGCAAACTCTCCTCAAACGATCTTCCTATACTCATGACCTCTCCCACGCTCATCATCTCA GTTGCTAACGATTGATCGACGTTCTCAAACTTGCTTAGATCCCATCTTGGGATTTTAGTTACTATATAGTCTAAACTTGG TTCAAAACATGCACAAGTCCTTCCAGAGACTTTATTTATAACTTCATGGAGTTCGTATCCTAGTGCTAGTTTAGCAGAAA CATATGCTAGTGGATAACCAGTAGCCTTACTAGCTAAAGCACTTGATCT