SSO6297

Coordinates:557801-558067

>SSO6297 89 aa !not a gene!
MANFLISPNEVADIQSGCEIPNLSNSFENFSLFSAISTLLPDVPNNLTPFSSNSLAIELPICPPENVATYLNFSFLIKSN
TLSTLISSK

>SSO6297 89 aa !not a gene!
TTGGCAAACTTCTTAATTTCGCCTAATGAAGTTGCAGATATCCAATCCGGCTGCGAAATACCTAACTTATCTAATAGTTT
TGAGAACTTTTCCCTATTTTCTGCGATATCTACACTGCTACCCGATGTTCCTAATAACCTTACTCCATTTTCCTCCAACT
CTTTAGCTATTGAATTGCCTATTTGTCCACCTGAAAACGTGGCAACATATCTAAACTTCTCCTTCTTAATTAAATCCAAT
ACTCTTTCCACGCTAATTTCGTCAAAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 557301 - 558567 (Additional range around SSO6297 is :500nt.)

>Sulfolobus solfataricus P2 TAGACCATCAAATATCGCTTTCATTGACTCATTTATTAGATTTATACCCTTTGCTTTGCTACTAAATGGCATTGATCTAC TTGCTCTAAGATTTAATTCGATTATATATGGAGTATTTTCTTTTACCACAAATTGTACGTTGAATGGCCCTTTAATATTC AGTTCTCTAGCTATATTTAACACATTTTCTCTCATTCTATTCACATTATTTTCAGACAATTTTCTAAAGGGAATTGACAT GGTTGCATCTCCGCTATGGACTCCAGCCTCTTCTATATGCTCTAATGTTATTCCTAATACCTTATTTCCATCTGAAACTC CATCAATCTCAGCTTCTATAGCGTTCTCGATGTACTTTGAAATCACTACTGGATATTTAGGAGAAATCTCAGTAGCTCTT CTTACATATTCATAAAGCTCCTCTTCTGAATAAGCTATTTTCATTGACGATCCACTTAGAACATAACTAGGTCTTACAAG AACTGGAAATCCTACTTCA TTGGCAAACTTCTTAATTTCGCCTAATGAAGTTGCAGATATCCAATCCGGCTGCGAAATA CCTAACTTATCTAATAGTTTTGAGAACTTTTCCCTATTTTCTGCGATATCTACACTGCTACCCGATGTTCCTAATAACCT TACTCCATTTTCCTCCAACTCTTTAGCTATTGAATTGCCTATTTGTCCACCTGAAAACGTGGCAACATATCTAAACTTCT CCTTCTTAATTAAATCCAATACTCTTTCCACGCTAATTTCGTCAAAA TAAAGCTTCCTCGCAATATCCCAATCAGTTGA GACAGTTTCCGGATTATAATTAAGTACTGCTACTTCATCAAAGTACTTTGATCCTGCTTCCATTAGAGATACAACACTCC AATCAAACTCAACTGAAACTCCTATTCTAAAACCTCCTGCACCAATTATTAGTAATTTGTTCCCCTGTGAGAATTCTATA TCATCTTCCGTACCATTATATGTTAAATACATGTAATTAGTAACTGCAGGCCATTCGCCAGCTAACGTGTCTATAAGCTT TACCACTGGTATTGTGTTGGTTTCGTATCTAATTTTTCTCACGTATTCAGTAGACTTATTTAGCGCTTTAGATATCTGCT CATCGCTAAATCCCAATTTCTTAGCGAGTTTTAATGTTTCCTTATCGATCTCTTTCAATTTTCTGAGAGTTTCGTAGAAA TCTACTAATCCTTTGATTTTATTTAAAAAGAACTCGTTAATTCCAGTAACCTCATATACTTCATTAAT