SSO6313

Coordinates:567128-567292

>SSO6313 55 aa !not a gene!
MFSHVLGFNRIVYTNTYIITPSAIKKAVKALSIKPNAVPKTARSEPTTITSFLLT

>SSO6313 55 aa !not a gene!
ATGTTTAGCCATGTCCTAGGTTTCAATAGGATCGTATATACGAATACATATATTATTACCCCTAGTGCTATAAAGAAAGC
AGTTAAAGCGTTATCTATAAAACCTAATGCTGTACCTAAAACTGCTAGAAGTGAGCCCACTACTATAACTTCTTTCCTAC
TGACA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 566628 - 567792 (Additional range around SSO6313 is :500nt.)

>Sulfolobus solfataricus P2 TATAGATATTAGAATTATAATCTCCTCTAAGAAAATAGCTGATATGGTAATAGATATCTCATATTAATTTAATTATTATT ATACTTAAAAGTATTAACATTAGGTAAATATTTGAAAATATGAAGGATTTCATTGCTTCTTCCTTGGTTGGATTAAGTAT TAACCTATAAGAAAGAAACAATAATAATGCACTTAAAACAGAAAACACTATAAGCGCTATAAGGCTAATGTAGTATCCCA TCAAAAGTACAATAGGAATCATTAAGGCATTAGAAGTTGCTATTGCCCTTGCAGAAGTAGTTATACCGACCACAGCAGGT AACATTGGATAATGAGCGTTAATGTAATCCTCTCTATATTTTAGTGCCAACGACCAGAAATGGCCTGGAGTCCACATAAA TATTAGAAAACCTAAAAGAAATGCTTCTAAAGTTAAAGAATTAGTTAAAGACGTATAACCAGCCCAAGCTGCAGCACTAC CAGCAAATCCACCTATTACT ATGTTTAGCCATGTCCTAGGTTTCAATAGGATCGTATATACGAATACATATATTATTAC CCCTAGTGCTATAAAGAAAGCAGTTAAAGCGTTATCTATAAAACCTAATGCTGTACCTAAAACTGCTAGAAGTGAGCCCA CTACTATAACTTCTTTCCTACTGACA TAGCCAACTACTGTAGGTCTATTTGATGTTCTAGACATTACTTTGTCTCTATT TATTTCTATTCCACTATTAATTATCATTGCACCCATTGACGCTAATGTACCTCCAATAAGCATAGGAATGATTGGTAAAA GTGAAATGCCGTGTTTGTACGCCAGAAAAGCCCCAGCAATTGCTGCCAAATCAAGAAGACTTACCACACCAAGTTTACCT AATTTTAAATAAGCCTTTATTTTCTGCTGTAAGCTCATCAAGTTACAATTGTATTATAAGAATAAAAAAATTGTCATAAA CATCCTTCCAATAATAACACTAAATCTGAAAGGGCACCGTATGCAGCATTTATCGGACCTGCACCTGGACCTCTAATGAT AATCCTCTGTATTTCATTTTGAATTTCTAGTGCATTTTCAACTCCATCTATATAGTATAAGGGATCTTGAGGCCCTATAA TTTGAGGAGAAACTTGAACTACATAGTTATCTGCATAGGCTATTAG