SSO6317

Coordinates:569650-569838

>SSO6317 63 aa !not a gene!
MIYGILYLVFSNLISCFKSPISIINYSNRITFIYSVTYVFSILCNGYFICYYSFVSNIGKTGS

>SSO6317 63 aa !not a gene!
GTGATTTATGGTATCCTCTATCTCGTTTTCAGTAATCTTATCAGTTGCTTTAAATCCCCAATTTCTATTATAAATTACTC
TAATCGAATAACCTTCATCTACTCCGTGACTTACGTATTTTCTATCCTCTGTAATGGTTACTTCATTTGCTATTACTCTT
TCGTATCTAATATCGGCAAAACTGGCTCC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 569150 - 570338 (Additional range around SSO6317 is :500nt.)

>Sulfolobus solfataricus P2 ATGTTACATCAGCCTCACTCAAATGCCCTATAGCCTCATGTGTAAAAATCCCTACTACCTCTGGAGCTAAAATTACTGGA TACTCACCAGCTTTAGGTGTACTTCCCTTTAATTGATTTATGATTCTCTTCTGAAGATTAGCTAATACTTGATTTATATC AAAAACGTCAAATATATAACCCATTTGAGTGCTTAATATCTCTGACACCTCAACAGTTACATCTCCTTCCCTTGCAACAA CTAAAATAGATAAACTAGAGGAGCTCCCATCAGCTATTATTTCTCTATCCTCTGAACTATAATATTCCTTATGAAAAATT TCATCATAATATTTTATGGAATATGATTTTATACTAGGATGAAGGGTATTAACTTGGCTCGCGACTTTGTGCAAATCGTT GATTTTTTCCTCTTCATTTTTGTTAATATCCTTACCAATTTTTATAGTATCATGTTTTGAAGGCAAATATACGATGTTAA CTCTTTCGTCACCATATAT GTGATTTATGGTATCCTCTATCTCGTTTTCAGTAATCTTATCAGTTGCTTTAAATCCCCA ATTTCTATTATAAATTACTCTAATCGAATAACCTTCATCTACTCCGTGACTTACGTATTTTCTATCCTCTGTAATGGTTA CTTCATTTGCTATTACTCTTTCGTATCTAATATCGGCAAAACTGGCTCC TAGCTCTTCAGCTTTTTTAATGTATTTAAA CATATTACTTTAATACTCTCTTGAGTATATAATATCAATGAGCGCTGAAAAGATAAGTATATCTTTGCCAAAAGAACTTT ATAGGGAACTAGAGGATTTCATTATACGAAAAGGTATACCCGATAGATCCAAGATCTTTCAGATAGCTTTGAGGAATTAT CTAGATGAGAATAGGGACGGCAATGAGATCATCTATGGTATTATAAATCTGGTATATGATCATGAGGAAGCATCTGAAGC GTTAACTGAAATTCAGCATGAATATAACGATAGTATAATTTCTACATTGCACTTACACGTTAGTGAAAAGATATGTATAG AGGCCATAGCTGTAAAGGGAGAGAAAAGGAAGCTTGTTGAGTTAAACAATAAATTAGGCCAAATTAGGGGAATCCTTAAA GCCAGGCTATTAATATCTTTTCCTTATGAAAAGACTTAGTATTTCTGAGGATGTTAGAAGGCTAGGGGTT