SSO6330

Coordinates:575195-575434

>SSO6330 80 aa !not a gene!
MSLPGTSLTINDTIGILSFTYSSILPPFTLDRCFLTIFILLIPNPEVTSTLLIIFNSSKGISEYSTSADAPPEIANITKS

>SSO6330 80 aa !not a gene!
ATGTCATTACCTGGGACATCACTAACAATAAATGATACTATAGGGATTTTATCTTTTACATATTCAAGTATTTTACCACC
TTTTACCTTAGATAGATGTTTCCTTACTATATTTATTTTATTAATCCCCAATCCAGAGGTTACGAGCACCTTGTTAATTA
TTTTTAACTCATCTAAGGGTATTTCAGAATACTCAACTAGTGCAGATGCACCCCCAGAAATTGCAAATATTACTAAATCG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 574695 - 575934 (Additional range around SSO6330 is :500nt.)

>Sulfolobus solfataricus P2 TGTCAGAACTGACCTTACAACCAGCATATTCTGAGTTACCGTCGATCCCATCAGTAGCGAAACCTAAAAGTTCAAATCTA TTTCTTTTTTTAGCATATTTAAGGAAAGATAAACATACCTCTCCATTCCTTCCACCTTTCCCTGCCTTTCCTTGAATTGT AACTTCAGGCTCTCCACCAACCAATAAATAGTAAGGTCTCCTAAAAGGTATATTGTAGCTCTCTGATGAATTATAAATCG AGGCGATAATAGCTCCAACATCTCTCGCCTCTCCTCTGATTTCAGAAGTAAGAATGAAAGAGTTCACCAGAGTATTCGCA AGCTTCCTAAGCACCTCCATGTTATCTAAAATTATGTAATTTTTTACGATTCTAGAGAAACTCTTAGGAGTCTCTGTTAA ATACTTAGAGTATTTCTCCAACCCTATAGCTTTTAAAATTTCTAACGCATCATCATTACTAGAATTATCAATACTAGTAA GACCACTCCCAATACTACTA ATGTCATTACCTGGGACATCACTAACAATAAATGATACTATAGGGATTTTATCTTTTAC ATATTCAAGTATTTTACCACCTTTTACCTTAGATAGATGTTTCCTTACTATATTTATTTTATTAATCCCCAATCCAGAGG TTACGAGCACCTTGTTAATTATTTTTAACTCATCTAAGGGTATTTCAGAATACTCAACTAGTGCAGATGCACCCCCAGAA ATTGCAAATATTACTAAATCG TAGTCTTCATTAGCTAGTAACTCTATCATCCTTTTCCCAGCCTTTATGCTGTTCTCGT CTGGCAAAGGGTGGCCAGCTTCTATAACATCATTTTCTTTTCCGTTAGTACCCTTTGGTGTCACTATTAATTTAGCCTTT AGCTCCATCCTCTCTCTGAAGAATCTCGCCATAGGTAGAGAGGCTTTCCCTATTGAAATTAGTATAGGTTTTTTAAATGG AATCTTTTCGTTGTTAAATAGAAGAATATTATTATATACCCTAACTTTCTCTTGTAAAGCCTTATAGGGATCTGTATACT CTAATATCTTATCAACAATATCCATAATTATCCATTCTCTTTTCTATATTCCTTATATAATAAGGATGCTACTTTTCTTC CCTCTTTACTTAGGTCATAATAAATTCCGTTGGGCTTATGATCTAGTTCTCTAGCTTTAACTTTTAACCACGGCTTTATA GATGACGTTACAGATTTTTTTAGTGAACCTTTAAATCTAAT