SSO6333

Coordinates:576741-576863

>SSO6333 41 aa !not a gene!
MTLVFILSTRFDALSSLAKTSINAFTVFPLIPSFCRVNFIL

>SSO6333 41 aa !not a gene!
GTGACTCTTGTTTTTATACTCTCAACAAGGTTTGATGCTCTTTCATCCTTAGCGAAAACTTCTATTAATGCGTTTACCGT
TTTTCCGCTTATACCTTCCTTTTGTAGAGTTAACTTTATTTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 576241 - 577363 (Additional range around SSO6333 is :500nt.)

>Sulfolobus solfataricus P2 CCATTCTTCCTCTCTTACTATCATTACAACCTTATACTTACCAGCAATATTTATTTCAGATAGTTTCTTTCCACTCACTT TTATCCTATTTCCTATTGGATGTCCATGAGGACAAGTTGTGGGATAACCAAGTAATCTATCTATTCTCTCCAATATATCA TCTGGCCAAATGTGTTCTAGCCTGTGTGCTAACTCGTGAGCTCTTATCCAGTCAACCCCAACTATGTCCGTTAATAAACG TTCACTAAGTCTATGAGACTTAATTAGTCTTTCCGCAATTCTCTTTCCCTCTTCAGTTAACTTTATTTTTCTATCATTAG TTCTCTCTACCAATCCTAATTTTTCCAATTTGTTTAACGCTTTACTTATTGTTCCTGGTGAAATGTTAAAAATAGAAATT AATTCTGACACTTTAGCACTACCCTTAATTTCCTCTATCTCATACATCTCTTTTAAGTAATTTTCTAAAGGTTCCGAAAG TTCAACCATATGTTTATATT GTGACTCTTGTTTTTATACTCTCAACAAGGTTTGATGCTCTTTCATCCTTAGCGAAAAC TTCTATTAATGCGTTTACCGTTTTTCCGCTTATACCTTCCTTTTGTAGAGTTAACTTTATTTTA TAAATGGCTTCATCA ACTGCTGCAGATATATGATCGTGTAATTTAGTTTCTATCTCAAAACCATATACCTTAGCTATTGCATAAAACTTCTGTAG CTCAGACCCCATTTCACTATAACTTTATCCTCAAATCAAAAATAAATCTTAGGTTCTAACTACGAACAACCAAAATATTA ATATAAAAATTTATCAATATAATTAACTGTGTACAAGGTCATTTTTAGAATTAAAGGAGGATATGGAACATCATTTAGAG AATTAAGACAAGCTGGCTTCACTCCAATTTATTTTAGAAGAGATAAAGGTGAGGAATACTATGTAACTATATTTACGGGT AAAGATTTGAGTGAGGTAAAGGAGGCAATTCTAGACTTATCTTACTATTTGTCTAAATGGGGGAAATATGGTGATCATAA CTTCGCAACAATATATGAAGTAAAGAATCAAAATTTAGGCAAGGTAGCCGGAGGTGCACTAGGTGCACTTGCAGGATATT ATCT