SSO6334

Coordinates:576737-576970

>SSO6334 78 aa !not a gene!
MGSELQKFYAIAKVYGFEIETKLHDHISAAVDEAIYKIKLTLQKEGISGKTVNALIEVFAKDERASNLVESIKTRVTI

>SSO6334 78 aa !not a gene!
ATGGGGTCTGAGCTACAGAAGTTTTATGCAATAGCTAAGGTATATGGTTTTGAGATAGAAACTAAATTACACGATCATAT
ATCTGCAGCAGTTGATGAAGCCATTTATAAAATAAAGTTAACTCTACAAAAGGAAGGTATAAGCGGAAAAACGGTAAACG
CATTAATAGAAGTTTTCGCTAAGGATGAAAGAGCATCAAACCTTGTTGAGAGTATAAAAACAAGAGTCACAATA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 576237 - 577470 (Additional range around SSO6334 is :500nt.)

>Sulfolobus solfataricus P2 TGGGCCATCCCAAAACACCAACTAATTTTTCTCCCATTTCAATATCTACTAACTCACCTAAAAATATTCCCCCAAGTGCA CCTATGACTAGTCCAGCCAATCCGCCAAGATAATATCCTGCAAGTGCACCTAGTGCACCTCCGGCTACCTTGCCTAAATT TTGATTCTTTACTTCATATATTGTTGCGAAGTTATGATCACCATATTTCCCCCATTTAGACAAATAGTAAGATAAGTCTA GAATTGCCTCCTTTACCTCACTCAAATCTTTACCCGTAAATATAGTTACATAGTATTCCTCACCTTTATCTCTTCTAAAA TAAATTGGAGTGAAGCCAGCTTGTCTTAATTCTCTAAATGATGTTCCATATCCTCCTTTAATTCTAAAAATGACCTTGTA CACAGTTAATTATATTGATAAATTTTTATATTAATATTTTGGTTGTTCGTAGTTAGAACCTAAGATTTATTTTTGATTTG AGGATAAAGTTATAGTGAA ATGGGGTCTGAGCTACAGAAGTTTTATGCAATAGCTAAGGTATATGGTTTTGAGATAGAA ACTAAATTACACGATCATATATCTGCAGCAGTTGATGAAGCCATTTATAAAATAAAGTTAACTCTACAAAAGGAAGGTAT AAGCGGAAAAACGGTAAACGCATTAATAGAAGTTTTCGCTAAGGATGAAAGAGCATCAAACCTTGTTGAGAGTATAAAAA CAAGAGTCACAATA TAAACATATGGTTGAACTTTCGGAACCTTTAGAAAATTACTTAAAAGAGATGTATGAGATAGAGG AAATTAAGGGTAGTGCTAAAGTGTCAGAATTAATTTCTATTTTTAACATTTCACCAGGAACAATAAGTAAAGCGTTAAAC AAATTGGAAAAATTAGGATTGGTAGAGAGAACTAATGATAGAAAAATAAAGTTAACTGAAGAGGGAAAGAGAATTGCGGA AAGACTAATTAAGTCTCATAGACTTAGTGAACGTTTATTAACGGACATAGTTGGGGTTGACTGGATAAGAGCTCACGAGT TAGCACACAGGCTAGAACACATTTGGCCAGATGATATATTGGAGAGAATAGATAGATTACTTGGTTATCCCACAACTTGT CCTCATGGACATCCAATAGGAAATAGGATAAAAGTGAGTGGAAAGAAACTATCTGAAATAAATATTGCTGGTAAGTATAA GGTTGTAATGATAGTAAGAGAGGAAGAATGGATTT