SSO6337

Coordinates:578795-579043

>SSO6337 83 aa !not a gene!
MPNAIPLTIGKCLILFLSIVSIQVEIFVKGCTTIASLLIPSTLPFTELQLKDLTTSFSVIIYFPLYSTKSELSPIIVPTI
LLM

>SSO6337 83 aa !not a gene!
ATGCCTAATGCAATCCCATTAACAATTGGTAAGTGTCTGATATTGTTTTTAAGCATAGTTTCAATACAAGTTGAGATCTT
CGTAAAGGGCTGTACTACAATCGCATCTTTACTGATACCTTCTACACTTCCCTTTACCGAACTCCAGTTAAAAGATCTTA
CAACATCCTTTTCAGTTATAATATATTTTCCTCTATATAGTACAAAGTCTGAGCTCTCACCAATCATCGTTCCTACTATA
CTTTTAATG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 578295 - 579543 (Additional range around SSO6337 is :500nt.)

>Sulfolobus solfataricus P2 CCTACATCGATTATTAAATCGCCATCTATAAACTCACCAATTTCTCTGAGAAAGGATGTATAAGTTTTACCAGAAGTGAT CAGCAATCCTAACGGAGCCCATATACTTTCGTAAATAGGAATTACTCTTGATAATAATTTATCGACCTCGACGTCTTTCA ATAGGAAATCATAAATTTGGCCTCCAATTATACCAAATTTGTGACCTTTTTCACACTCTAACTTCTCATTTACATCACTT CTATCAATAGGGCAAGAGAATATCACAATATATAACTAAAAATCAACTTTATTAAATCTCTGTTAGTAAGAATTTTAACT TTGTTCTTAACTCTAGTTTTAACTATTAGACTACCAACATTCCTCCCTATCATTAAATTTATCGCATAACTTAACTCACT ATTATCGTCTGCAGTAACTAAATTTACATTCATAATTTTTTCAACTATTGTATTTCCAGTTACTGAGTCATAAGAATAAG CTATATCTCTTGCACTAACT ATGCCTAATGCAATCCCATTAACAATTGGTAAGTGTCTGATATTGTTTTTAAGCATAGT TTCAATACAAGTTGAGATCTTCGTAAAGGGCTGTACTACAATCGCATCTTTACTGATACCTTCTACACTTCCCTTTACCG AACTCCAGTTAAAAGATCTTACAACATCCTTTTCAGTTATAATATATTTTCCTCTATATAGTACAAAGTCTGAGCTCTCA CCAATCATCGTTCCTACTATACTTTTAATG TAGTTGTCCTCGACATATACTGGCCTTCTTAACTTTAACTCGTTTAGCC TTACTTCTAATCTATTTTCCAAAATTTGCCTAATAGCGTTCTCTATTGTAAAAACTCCTATTATATTGCTGGAATTACTT ACTACTAATCTTCTCACGTTATTTCTCCTCATGAAGAATAAAGCGTCCGTTACATACGCATTAGGATCCAACGATATAAT TTCAGCTCCATTAATCTGAACTGACATTTTTAACTCCTAATACTTTCATCAAATTATAAAGGGTTAGTAATAAAGCGTTA TCTGATGTTACCTCTACTTTCACATTATCCAATATTAAGGCTCTATTCGTCTTTTGACACTCTTTTTTTATATCGTTTAT AACTTGTTTACTTATGGCTTCAACTTCATTTACGTTATTGATAATGTATTTCTTACCTATATCCACATTCGAAAAACCCT CTACAAGGATAACATCTACTGGGAGAAGTGTAATTAAGGTAAGGGAGGAT