SSO6348

Coordinates:581748-581879

>SSO6348 44 aa !not a gene!
MLIRYFIVNFYQIQNGQEEEGARWATTTEWRRAEKEITGIKPIL

>SSO6348 44 aa !not a gene!
ATGCTTATTAGGTATTTCATTGTGAATTTCTATCAGATACAAAATGGCCAAGAAGAAGAAGGAGCAAGGTGGGCAACAAC
AACAGAGTGGCGGAGAGCAGAAAAAGAAATAACGGGCATCAAACCTATATTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 581248 - 582379 (Additional range around SSO6348 is :500nt.)

>Sulfolobus solfataricus P2 ATTTAGTAGATTATGTATGTAGCAAACCATATGACATCGTAATTCCATTTGATCATAGACCACAGCCACTGTTAGCTTGT TATTCCACAGAACTGCTTAATAAAAACATTGATAAAATTAATGGACTTGTAGAGCTGATTGAACTCTCTAGCTCAGTATA TTTTATCGGTACTGAAGAACTATTAAAGATAGATCCTTTTCTTTATAGTTTGATTAATATCAATAGTATAATAGATCTAA TTTATCGTCCAATTAGAATAAAAACGAAATCAAATTTTATTCTTAGATAAGTGAAAATACATTCTTGATATAGAGACCAA GGTTTTACAATAAAAAGTTCATTAGCAAAACATATTCTCTTTTTAAAGAAGAATAAAAAATTTCTAAAGTAATACGGTAA TATATTTAAAGATTTATGGTACTATACTTTGCCATAATGAATTAAGATCATGATTGGCGTAACTTTTTTTCGATAATATT CTACTAAGATTTCATAAGGA ATGCTTATTAGGTATTTCATTGTGAATTTCTATCAGATACAAAATGGCCAAGAAGAAGA AGGAGCAAGGTGGGCAACAACAACAGAGTGGCGGAGAGCAGAAAAAGAAATAACGGGCATCAAACCTATATTA TAGTAA AGTATTAAAGTTAATCCCTTTTTTACCTCCTTATATCCTATGAAAATTTGTGTGTTATACTCCGGAGGGAAGGATAGTAC TTACGCGTTGCATTGGGCAGTTTTCAAAGGATTTGAGGTTGTCTGCCTAATAACGCTAATACCGAAAAGAGAAGATTCTT GGATGTTCCAATATCCTAACGTGATTTATACTAAATATCAGGCTGAAGCCATGGATTTTAAGTTAATTACCTTCGGGACT TCAGGAGAGAAAGATAAGGAACTAGAAGATCTCAAAAAGGCGTTATTACAAGCTAAAAATGAAGGTGCTGATGGAATAGT TAGCGGAGCGTTACTTTCCGATTATCAAAGATTAAACATAAGCATAATAGCCGAAGAATTAGGACTAAAGACATATACTC CGCTTTGGAGAAAAAGCCAAGAAGAATATATGCGATGGTTAGTAAAAGAAGGATTTAAGTTCATAATAACATCAGCCTCC GCCTATGGTTTTC