SSO6369

Coordinates:595158-595304

>SSO6369 49 aa !not a gene!
MGHLVRLLFEEFKLSFKLMKLLSILAGNIKYAKEGIVLRLRNRRTIGVM

>SSO6369 49 aa !not a gene!
TTGGGGCATTTGGTGAGACTGCTATTCGAGGAATTTAAACTAAGTTTCAAACTAATGAAATTGTTGTCAATACTTGCGGG
CAATATAAAATACGCCAAAGAGGGAATAGTATTACGTTTACGAAATAGAAGGACGATAGGAGTAATG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 594658 - 595804 (Additional range around SSO6369 is :500nt.)

>Sulfolobus solfataricus P2 AACTGTCAGATACGTAATTAAATTATATGACTGAAATACAAAACCTATATATCTTCTTCTAAAAATTGCTCTCTCATCTT CATCAAAATTCGTAACATCTATTCCATCTATTATTATTTTACCAGCACTAGGTGAATCTAAAAGGCCTAGCAAATCTAAA AGTGTGGTTTTGCCAGATCCAGAAGGACCAGCAATAACCAAGAATTCTCCTTTATTTACTTTCAAAGTTACTCCTCTTAA TGCAACGTATTCAATATTTTTAGTTTTGTATACTTTCTTTAAATCCATAGCATCGATTAAGATATCGGTCATATAATCGA CTCTATTGGCTCCCTCTAAAAAATCTTTTGGCAATAGATGCTAGTGTAGACTAGAGTTTTGTTAATTTAGTATAAATCAT TTAAAGTATCCGTTTATCTCCAATTTAACATATGATTTAGCTGTCATCAAGAAAGAAGATGTCACAATTTTTAATCTTTT TCAGAAACTTTGTTACGTAG TTGGGGCATTTGGTGAGACTGCTATTCGAGGAATTTAAACTAAGTTTCAAACTAATGAA ATTGTTGTCAATACTTGCGGGCAATATAAAATACGCCAAAGAGGGAATAGTATTACGTTTACGAAATAGAAGGACGATAG GAGTAATG TAAAGGAACGTTACATACGTGCTTTAGACAATATAATTGAAACGCGCATTAATATTGAGGATGTGGGGGAT ACCCCACAGTGCCGCCGCGGGGACTTGAACCCCGGACAACCCGGTCTTCAGCCGGGCGCTCTCCCGGGCTGAGCTACGGC GGCATAATAATAATATAGATATGACTTTTTAACTTTTATTGTCATTACTTCTAACGGGGATCTGGCGACACCCTTGGAGA ACCCTAAATATTTAGGGATTCGATGAATTAGGGTCTCCAGAGATCCCCACAGTAGGTGACGGAAATGAAGATTTTAATAG TTACCCTAACTTACATTGAAAAATCAATAATAGATGAAATTGTTAATAATCTTTCAAGCTATGGATTAGAAGTTGATATA TTGTTAGATAGTAGGAAATATCTTCCTATTTCTGCCTTTAATTGGGAAAGATTGCAATACGACGCTGAAAAAGTATTGAG CTTCCTTAAGTCAATACACGACTTTAAC