SSO9697

Coordinates:1904623-1904742

>SSO9697 40 aa !not a gene!
MLSFPNSKVCSLTTFVFKSSNTVTLFSKAFSIFPMPSKGS

>SSO9697 40 aa !not a gene!
GTGCTCAGTTTTCCGAATTCAAAGGTTTGTTCTCTTACTACGTTTGTCTTCAAATCCTCAAATACTGTTACCTTATTCTC
TAAAGCTTTTTCAATATTTCCTATGCCTTCCAAAGGTTCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1904123 - 1905242 (Additional range around SSO9697 is :500nt.)

>Sulfolobus solfataricus P2 TCCAGTATATCTTATACCTCCAATTTTATATGGTCCAGTTAAGAACGCTAAAGGTTTAAAAGGTTGACCAGCATCCCTAG AGGCACCAACGTCTTCCCATATGTGAACATCTAAACTATTTACCCTTCCATCAGAGGAATAATAGGCGTGGATTTTGAAT TTCCTCTCTGGTCCACTTCCATTTGATGCCATTAAATGCTCATTTCTAGTCTCAATCCACTTTATTGGTACTTTAAACTT CAATGCTGCAAAGCCTAATACTGTCAAGTATCTGACTAGGGAGAACTTCTCACCGAAGCTTCCTCCTTGCCTAGCGTTTT TATGTACTACCTTAACTCCTAACGCCTTCTGTATTTCGTTGGATACTACGTTCCCTGCTTGCTGATTCGAAATTATGGTC AAACTATCATCTGTTGGAATTGTGATTGCCCCATAAGGTTCTATTGGATTTCCAGAGCTTCTAGACCAGTATAGGTCTAA TTCTAAGTGCCTACCTTGT GTGCTCAGTTTTCCGAATTCAAAGGTTTGTTCTCTTACTACGTTTGTCTTCAAATCCTCA AATACTGTTACCTTATTCTCTAAAGCTTTTTCAATATTTCCTATGCCTTCCAAAGGTTCA TAATCGATTTGAACTAATT CCGCTAAATCCGTAGCCTCATATGGATCATTTGCAATAACTAAAGCTACTGGTTGGCCAACGTATAGTGCCTTATTTATC GCCATTAATGGAGTTGTCAAACTTGCTCCTTCTCTTTCGCCAGATTCTACATTTCTAGATACTAAATCTTTACCTGTTAG AACTAATGCGCCTCTTCTTTCTGCATCTTCTTTATTGATGTTGACTATTCTAGCATGGGCGTATGGGCTTCTGATAAATA CTGCGTATTTTCCCTTATACGATATATCATCTACATAATTACCCTTTCCTATTAATAGGTCATATGCGTCTATTCTTCTC ATTGCTTGTTTGTTAGTTATACTTCGTCAGACTTTAAAGGGCAAGAAAACTTCACTCAGTATTGACGTCCAAGGTTCACC GCACCTCTTCACACTATACGTAAGGTCATTTACTCTCTTGGATATGGAGCGTAGGAACCTCGTTGCATCCCACATTAAGG T