SSO9711

Coordinates:1910231-1910365

>SSO9711 45 aa !not a gene!
MFLPAYYHVLVICWSFCTTIPTIVLVHSILIVKSIRFIVFLIITD

>SSO9711 45 aa !not a gene!
TTGTTTCTCCCTGCATATTACCACGTTTTGGTCATTTGTTGGTCCTTCTGCACCACAATTCCAACTATAGTTCTCGTTCA
TTCCATCTTGATTGTTAAATCCATTCGCTTCATTGTGTTTTTGATTATAACTGAC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1909731 - 1910865 (Additional range around SSO9711 is :500nt.)

>Sulfolobus solfataricus P2 TTTCTCTCAAATAAGAACTGATAACTAGTTCCCATTTACCTTTTGGGAATTTCACCTTTACGTTATTGGGATTTGCGTTA AGTATTATTAAGAAGGAATCATCAGCAATTCTCTCTCCATACATATTAATCTCGTCCATAACACTTCCCTCCAACACGAA AATAACTAGTTGCGTCGGGGAACTCCATGTTTTCTCATCAACTTCCCTACCTTCTAGAGTATAGAAGGTCACATCTTTTA ACGGCATGCCGAATAATTTCTTTCCTTGAAAATATCTTTCCCTTCTGAATGCTGGATGTGCCCTATAAAATTGGATCATC TTTTTAACAAACTCTAAAAATTTTGATTTTCTCTCATCTAAATTCCAATCAAACCAAGTTATCTCGTTGTCTTGACAAAA CGCGTTATTATTTCCTCTTTGTGTCCTGCTTAGCTCATCTCCTCCCAATATCATAGGGGTTCCTTGACTAACGAGTAACG TTATCATAAAGTTCCTTTT TTGTTTCTCCCTGCATATTACCACGTTTTGGTCATTTGTTGGTCCTTCTGCACCACAATT CCAACTATAGTTCTCGTTCATTCCATCTTGATTGTTAAATCCATTCGCTTCATTGTGTTTTTGATTATAACTGAC TAAA TCCTCTAATGTGAAACCATCATGAGAAGTTACGTAATTTATACTGGCAAATGGTGTTTTATTATTACCTAAGTAAATGTC CGGCGAGCCTAATAATCTGTTAGCAATCTCGCTATAGGGTAACGCTTCTCCTCTCCAAAATCTCCTTATCGAATCCCTAT ACTTTCCATTCCACTCTGCCCATTGATATGGGAAATTCCCTACTTGATATCCCCCTTGTCCCACATCCCAAGGCTCAGCT ATCAGTTTTACTTGTGACAATATTGGGTCTTGCTGTAGAGCAATGAAGAACGTATTTAACATATTAACGCTGTATAATTC CCTGGCTAAAGCTGCTGCTAAGTCAAATCTAAAGCCATCTACGTGCATCTCTGTAACCCAATATCTTAAGCTATCTAAGA CCATCTGGATGACTCTAGGATGGCTAAGATTTAACGTATTGCCAGTTCCGGTAAAGTCTAAATAATATCTTTTATTATCT GGTTGGAGCATGTAAT