SSO9719

Coordinates:1912932-1913078

>SSO9719 49 aa !not a gene!
MYTPLLISSFLIQSTLFCLILIFSLTSLVTIGEKRTVTFPLWKPKGNGL

>SSO9719 49 aa !not a gene!
TTGTATACTCCACTACTAATTTCCTCATTTCTGATCCAATCAACGCTTTTTTGCCTTATACTAATCTTCTCTTTAACCTC
CCTAGTCACTATTGGTGAGAAAAGGACAGTTACTTTTCCCCTTTGGAAGCCAAAGGGTAATGGTTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1912432 - 1913578 (Additional range around SSO9719 is :500nt.)

>Sulfolobus solfataricus P2 GTGCTCCTCAGCTTGATTGAGGCATGCAAAACGTCATTTGGAGGACTCCTGGATCCGTTGCGAATTGTAATTTATAAACA GTATAAGTATAAATGTGTTAACGCGATTCATAGTGTAATCACTGAGCTACAAATTAATTAGGTTAAATGATCTTCATGAG GAGAAGACGTTAAACTGATATACTTAATATACGTTTGAATATTAGAAAGAAAATTTATAGCTTAATAATGACACCATGAC GCGATTAAGCATGAATTCCCTTTATTAACCGTTTTTACTCAGTTAAATTTATCATAATTCATGAAAATATAGTGAATTTG TAATGGAAACCTAAATGGCCCAGAGGAATCACATGCTTCATCTCTTATATAAAACATATTACTCAGATCTGAGTAATGCA TATCTGACAAGAGTAGTTCAGGAATAAATCTATATAGGTAGTTCACCCACTTTTTCAGTTAATATAACGACTCTATGCTC CCCAATCAACTCACTTAAA TTGTATACTCCACTACTAATTTCCTCATTTCTGATCCAATCAACGCTTTTTTGCCTTATA CTAATCTTCTCTTTAACCTCCCTAGTCACTATTGGTGAGAAAAGGACAGTTACTTTTCCCCTTTGGAAGCCAAAGGGTAA TGGTTTA TAATCGTTTAGTGAGTACTCTCTTCTAAGTTGTAGCAATTTCTTAACATATAACATTTTGACTCTTGGATCT GAGAGTTCTAAGTTCTTTTCAGTCAAATTATTTAATAATTCCCTTAGTTTCTTGAAATCCACCGGCATTCTGTTATCTGG GTCTGTAAGTAAGAATCTCCAAACTTCAGTTCCTTGATAAATATCTGGTACACCAGGCGAAAGGAATTTAAGTGTCGTTG CAACTAATGATTTCATATAACCGAAATAAACTATTTTCTTTTCAAAACTTTCAAAATCATTTCTAAAATTACTGTTCTCG AACGCTTCATCTATGAAATCCAAAACTTTATTTTCATACTCTATATTAGGATTTTCCCACGTTGTATGTACCTTAGCTTC TCTTATGACCTTAATCATGTGGTTCTTAATTCTCTCCTTATTATCAAATCCCTCGTAACTTCCTACAAGTGTTTGATAAA ATCTATACTCGTCATTTTTATCTATATT