SSO9724

Coordinates:1914151-1914375

>SSO9724 75 aa !not a gene!
MKSTITVSKKVKEVLERKKKEMEIKLNKPLSWDEFFQNIFREEEERIPKLTEEEAEILKDLTKEDRKNWRIREFV

>SSO9724 75 aa !not a gene!
GTGAAGTCAACAATAACTGTCAGTAAAAAAGTCAAGGAAGTCCTTGAGAGGAAGAAGAAGGAAATGGAAATTAAGTTAAA
CAAACCGTTAAGTTGGGACGAATTTTTCCAGAACATATTTAGAGAGGAAGAGGAGAGAATACCGAAATTAACTGAGGAAG
AGGCTGAAATTCTTAAGGATTTGACTAAGGAGGATAGGAAGAATTGGAGAATAAGAGAATTTGTT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1913651 - 1914875 (Additional range around SSO9724 is :500nt.)

>Sulfolobus solfataricus P2 GGCTTCATAGGATTTCATGATATTTCATCTCAATCCTCAGCCCTTGGGCTTCACCAAAGTCACGGACGTTCATCCCTCTC CGCCCCATTAGCGGAATAACCCCAACCCACACCCGTGAACGGATGTGAGGAAATCCGCACATCCTGTATCTCAACACCAG CCTTTCGGGATACGAACCCACATTTGGTGGTGCGTCATCAGATTATATTATATGTGTTTTTCATATTATCCTATATAAAC TTTACGGTTTATCGGAAACCGTTGGCAACGGTGAATTTTCCGCCGCCCCCAACTTTACAGAAATTACATTATCATGTGTA TGTGCTTAGTTGATCTGTTGGATATTTTTACACTAAACCACTATTATCTTCATTTCAATTAATCTCAAGGTCTACAATTT AGGCTTGTGAGATATCTTAAACGTTTGCTAAAAATTCAACAAGTCCACAAAGCAATGTGTATGATAAACTTTATATAATC ATGTAATTATATAACTATGT GTGAAGTCAACAATAACTGTCAGTAAAAAAGTCAAGGAAGTCCTTGAGAGGAAGAAGAA GGAAATGGAAATTAAGTTAAACAAACCGTTAAGTTGGGACGAATTTTTCCAGAACATATTTAGAGAGGAAGAGGAGAGAA TACCGAAATTAACTGAGGAAGAGGCTGAAATTCTTAAGGATTTGACTAAGGAGGATAGGAAGAATTGGAGAATAAGAGAA TTTGTT TAGATACGGATGTACTTATAGATGCTTTTAGAAATGATATTAAGAAATTCATAGGTTATTACACTACCTGTAT TAATCTTTATGAATTCTTGAGAGGATTAGCCTTTATTGGGAAAAATATAGATGAGTTCAAATCGTGGATAGAACTTAACC TTAACGTAGTATGTATTGATAATAACTCCCTAAAAACTGCTTCAAGAATTTACGCAGAACTTAGAAAGATGGGAGAAATA ATTGAAGATCCAGATTTATTAATAGCTTCGATATGCATAGCTAATGACTTCTCTCTAATGACACATAATAAGAAACATTT TAAAAGATTAGAGAAATACGGCTTAAAACTAATTTAGACAAGCGTTTTTAAAACATATTAAACATATTTATTACAGAAAC TAGAGAATATAGTGTAAATTTGCTTTACTGTTAAATTCACTAAAAATTCACATTTGAGTGTATACCTAACTAAAGAATAG CAGAACAAAGTTTGCCTGGTTGGTTT