SSO9725

Coordinates:1914132-1914266

>SSO9725 45 aa !not a gene!
MFWKNSSQLNGLFNLISISFFFLSRTSLTFLLTVIVDFTHSYIIT

>SSO9725 45 aa !not a gene!
ATGTTCTGGAAAAATTCGTCCCAACTTAACGGTTTGTTTAACTTAATTTCCATTTCCTTCTTCTTCCTCTCAAGGACTTC
CTTGACTTTTTTACTGACAGTTATTGTTGACTTCACACATAGTTATATAATTACA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1913632 - 1914766 (Additional range around SSO9725 is :500nt.)

>Sulfolobus solfataricus P2 TCTGTAATAAATATGTTTAATATGTTTTAAAAACGCTTGTCTAAATTAGTTTTAAGCCGTATTTCTCTAATCTTTTAAAA TGTTTCTTATTATGTGTCATTAGAGAGAAGTCATTAGCTATGCATATCGAAGCTATTAATAAATCTGGATCTTCAATTAT TTCTCCCATCTTTCTAAGTTCTGCGTAAATTCTTGAAGCAGTTTTTAGGGAGTTATTATCAATACATACTACGTTAAGGT TAAGTTCTATCCACGATTTGAACTCATCTATATTTTTCCCAATAAAGGCTAATCCTCTCAAGAATTCATAAAGATTAATA CAGGTAGTGTAATAACCTATGAATTTCTTAATATCATTTCTAAAAGCATCTATAAGTACATCCGTATCTAAACAAATTCT CTTATTCTCCAATTCTTCCTATCCTCCTTAGTCAAATCCTTAAGAATTTCAGCCTCTTCCTCAGTTAATTTCGGTATTCT CTCCTCTTCCTCTCTAAAT ATGTTCTGGAAAAATTCGTCCCAACTTAACGGTTTGTTTAACTTAATTTCCATTTCCTTC TTCTTCCTCTCAAGGACTTCCTTGACTTTTTTACTGACAGTTATTGTTGACTTCACACATAGTTATATAATTACA TGAT TATATAAAGTTTATCATACACATTGCTTTGTGGACTTGTTGAATTTTTAGCAAACGTTTAAGATATCTCACAAGCCTAAA TTGTAGACCTTGAGATTAATTGAAATGAAGATAATAGTGGTTTAGTGTAAAAATATCCAACAGATCAACTAAGCACATAC ACATGATAATGTAATTTCTGTAAAGTTGGGGGCGGCGGAAAATTCACCGTTGCCAACGGTTTCCGATAAACCGTAAAGTT TATATAGGATAATATGAAAAACACATATAATATAATCTGATGACGCACCACCAAATGTGGGTTCGTATCCCGAAAGGCTG GTGTTGAGATACAGGATGTGCGGATTTCCTCACATCCGTTCACGGGTGTGGGTTGGGGTTATTCCGCTAATGGGGCGGAG AGGGATGAACGTCCGTGACTTTGGTGAAGCCCAAGGGCTGAGGATTGAGATGAAATATCATGAAATCCTATGAAGCCCAA ACCCCTATGGGATGGA