SSO9739

Coordinates:1919688-1919816

>SSO9739 43 aa !not a gene!
MYLTRLNIAIIPSSKLLIIIPTTLAVPIIYNPVSILIQLLGYL

>SSO9739 43 aa !not a gene!
TTGTACCTCACCAGATTAAATATAGCAATAATCCCTTCAAGCAAGTTACTCATAATTATTCCCACTACTCTTGCGGTCCC
AATAATATACAATCCAGTCTCCATTTTAATACAGCTATTGGGTTATTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1919188 - 1920316 (Additional range around SSO9739 is :500nt.)

>Sulfolobus solfataricus P2 TTGAAAGCCTCGCCCCTTCTCGGTAGATCCAAAATCGTATTATTAAAAATAATAGTTTTCCGTTAATAACTAATTATAGC GCATTATACGGTTATCTTACTCAATTCTATAAAAATTTATGGAAAATCTTAGTATCACAACAATGTCTTTTTATAATAGT TAACATAAAAAGTATTAATTAATATTAATATATCAAAAATAGCATTAGATTCGAAGAAATTTCATTTTATTTATATTATT GGATACATATAATTGAATTTTAGGTAATCAATAATAGGTGTAATAGGATAAATTTTCTTATATTTTAGGAAATAATATGA TAATCTTTATTGAATTTACATTTGTAAAATGATTTTGGGAGTACCGTACACTGCAAAGGCCGACAACCTTAAGCTACTTT CTTTAGATAACAGGTTAAAAGAGATCGAGAGAGAATTATTATACAAAATCTAGATAAATAAATATTATATCTTAAGATTT TATATTCAGAGTACTTAGC TTGTACCTCACCAGATTAAATATAGCAATAATCCCTTCAAGCAAGTTACTCATAATTATT CCCACTACTCTTGCGGTCCCAATAATATACAATCCAGTCTCCATTTTAATACAGCTATTGGGTTATTTA TAGATTAATA CAAAATTAAGAAAAACAATTGTTTAGAATGACAAGTAACCCTTCAACACAAATGAGTTAAATTAACGTTTTAGAGATCTG TTTGTCTGGGTTCAAGCCTTCGCGGCACTGAAATTCTTCCTAGATTAGATCATCTACCTAACTACAGAGATGAATATGAA TATCCTAGGAACAAATACAGTTTCAGTTTAGTTGACGCTCTCCTTAAAACCGTTTAGATATCACATTATCATACACGTTG AGCTTTAGATTTTTTGGACGTATGAATATTACTCTCATCTATTAAATTTTTTAGTACTGATATTGAATAAAAACAACCTA TATTCCTTGTAGAATAACAGATACTAATTCTAAGATGAAGACTTTACAATATTTTTCGCAAAAATATTTACGTTCTATTG AGTATCCAACATGCAACTGAATTGGAGAAAAGTTTCGAATAATCGCTAATAATATGATCTAAATATTTTTTATGTCATAT ATTTCTTGTA