SSO9741

Coordinates:1921004-1921141

>SSO9741 46 aa !not a gene!
MKEISNNFFLTPYNLPTKSCSVLFPTFLPTNQATTTFTLTIFTASL

>SSO9741 46 aa !not a gene!
TTGAAGGAAATCTCCAACAACTTCTTCCTCACCCCGTACAACCTGCCCACGAAGTCGTGCAGCGTGCTCTTCCCCACCTT
CCTCCCCACGAACCAGGCCACGACCACGTTCACGTTGACCATTTTCACCGCGTCCCTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1920504 - 1921641 (Additional range around SSO9741 is :500nt.)

>Sulfolobus solfataricus P2 CCAAGTCGTAGTCCCGTAGGGCCTCCAGAACGCGTTCAGGTAGGTGCCGAAGAACTCCACGTGGGCCCTCAGGGTAGTGA AGGGCTTCTCCCGCGCTATGAGCTGTGTCGGGGAGGGAGAGAATCCCCTGTCCGCGATCTTAATCCCCTTGAGCGGTGAC TTGAACCTCTTGTCCGAGAAGTTGGCTGGCTTCAACGTGATGGACCTCACGAAGAGGGAGACGGAGATCACGGCCACTGC CTTGAGCCCGTAGTGCGAGACCCCTCTCTTCTTGGTCCACCTTCCCTCGAACCTCCTCTTGGTTCTCCCCAGGGAGAGCA GCTTCCCGGCCCTCTCCAAGTTACCTTCCCTCCTCTCCAGCTCCGCCTTCTCCCGAAAGGTCTCCACGCTCCTCTTCCCA GGAGGTAAGTCCAGTAGGAAGGAGTCCACTAGCCACGCCATGAAGTCCACGAGATGCGCGCTCGCAGGGAGGTAACTGGG TAGGCACTTCTCCTCAAGC TTGAAGGAAATCTCCAACAACTTCTTCCTCACCCCGTACAACCTGCCCACGAAGTCGTGC AGCGTGCTCTTCCCCACCTTCCTCCCCACGAACCAGGCCACGACCACGTTCACGTTGACCATTTTCACCGCGTCCCTA T AGGAGCAGGAATAGAGCACCATGACGATTAACAACTTCAGGTAAACCAGCGCGCCCTCGCCAAGGACCCTCTCCAAATCC ATGGCGTCCAGCACGGGCTTGATCTCCGTTAACCATTTTTCCCTCCACGGCATATCCTCTATTGGGGGAAGAGGGTAGTA CATCAGGTTTGGTATGTGTCTTAATGTTCTTGCCATGGTACTACCCTCTACTCCCATAACTTAAGTGTTACTCCAATTTA ATCCAAGATAATACTAGAAACCAATTTATTCTTGCCAATAAAAATTCAATTTTTTACATTCCGGACACTCTCACGTGAAA ATTGAAATTGGGATCTCTTTCATAGGTTAGCGGACAAGCCAGATATTCTATTTAATATAATAAATGAAGTTCTCGCAGAA GGCGATTGCCTATTTTATATAGATAAAATCTCTGCGGCCCTGGGAATAGCTTACGCTAATGTTAAGGACGATAGGATTCT AGAGCTTATGAGCCATGCA