SSO9749

Coordinates:1922220-1922351

>SSO9749 44 aa !not a gene!
MPLPKYNYLEFSPFFLFYTLNNKILIHKALYSFIHIIFLNKKTK

>SSO9749 44 aa !not a gene!
ATGCCACTGCCAAAGTATAATTATTTAGAATTTTCTCCGTTTTTTCTCTTTTATACGTTAAATAATAAGATTTTAATACA
TAAGGCTTTGTATAGTTTTATACACATTATTTTTTTAAATAAAAAGACAAAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1921720 - 1922851 (Additional range around SSO9749 is :500nt.)

>Sulfolobus solfataricus P2 CAGAACGTAGAGCCGTTCAGCTCTGAGACGCACCTCCTCGCGATCAGACAACGCTATGCGCGATAGGTAAATCCTCTCGT CTTGATATTTTTCCATTATAAAGTTTTTCTCGGTGATCCAGGTCCTATCCTTCTGGCAATATTAATATTTATCATTCTGT TTATCTATTCGTTCAGATAATTACATTCCGGACACTCTCTCGTTACCTTTTGACTTCTGAAAGGCTTCCAAAGCAATGTC TAAGTATCTTTCCTTTTTAGTGTATGCATAAGCTGTATTAGCGGAAAGTGCGTATAGCATAATATTCGTACCTTTATCTC CATGTTTAATCCTCTCTATACTATCAATTAACTTGTCAACCTCGTCAATTTCATTGAAGATGGAGTGATAGCTCACTAAC GAGTGAGCGGAGAAATAGAATTCATAGTCATATTTCTTTAAGCCTTCCCTTAAACTCTCCACGAACTTCTCGCTTTCTTT AATTCTTCCTAGACCTCTTA ATGCCACTGCCAAAGTATAATTATTTAGAATTTTCTCCGTTTTTTCTCTTTTATACGTT AAATAATAAGATTTTAATACATAAGGCTTTGTATAGTTTTATACACATTATTTTTTTAAATAAAAAGACAAAA TAGGGT CTATTATCTTGTATTCATCATTTATCTTATCTACAAGTCCTCGATTTTTTAGTATTTTTATTACTCTATATATATTTGAT ACTTTGATTTCGCTTAATTTATTACCTTTTGCTAGGCCTTTCAATACCTTAATTTCGTTCTTTGTAAGCCCCTCTAGATC TTTTTTCAACTCTATCTCTACATTAGGATCTTCAAGAATGGCTTCAATGTTACATTCCCTCTCAAATATCAATCCGGCTA AATTCAACCACGCGGGGATACCTTCGGTTAATTCATAGACTTTTTCGTAATATTCTTTACATTTTCCTTTAAGCCCTTCA TTTAAGAACCTTATTGACGTTTCTTTGTCAAATGATTTAAGTCTCTCTATTTTGAAATAGTTGTAAAATGGTTCTTTAGC CTCAGTTATCATTTCCTCTATTATACCTGTTTCAGATCCAGAAACTATTATTTCAACGTTTTTACTTTCTTGTAATCTTT TCCTAGTTAACTC