SSO9755

Coordinates:1924134-1924316

>SSO9755 61 aa !not a gene!
MTATTEGKITNNNVSSSHFKKDILFLSISVPFLSISIPPSLAIYNHISKKNLLATQTSLLT

>SSO9755 61 aa !not a gene!
ATGACTGCCACTACTGAAGGCAAAATCACAAATAATAATGTTAGCTCAAGCCACTTTAAAAAAGATATCTTATTTCTTTC
TATTTCTGTCCCCTTTCTTTCCATTTCTATCCCTCCCTCCTTAGCTATTTATAACCACATATCTAAAAAAAATCTATTAG
CAACACAGACCAGCCTTTTGACA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1923634 - 1924816 (Additional range around SSO9755 is :500nt.)

>Sulfolobus solfataricus P2 TTTTTATTTAGATAACTCCTCAGTTTAGCCAGATATTGCTTATCTTTCTCCGAAACGGTACTTATACGTTTCAATCTTAC TCCTCAAATTATCAACCAACAATCTAGTCTCAAATCTCACATCCTTTCCCTTCATAGCCTCCTCAGCCTTTGATAAGTAT TCCTTAGCCTTCAAATAGAGGTCTTTATTATCATAAGCAACGGCATTTTGCAAATACATCATACCAATCATAGCTAAACG TTTAATATACTCTTCACCTTTAACAAATTTTAGCCCAGCTTCGAAACTCTTAATATACTTTTCGTCAATTGGTTGTCCAC TATCTGGTAAAATTGGAATAGATGTTCTTTTCATAAAGGGAGTTATAATGCCATGACTTTTGCGGTACTTGCCAAAATAA GCCACTGAGATGCCAAATACTATTATTGGAATTATTGTACTAAGAGTGTTTGCTAGTGTTATGTTATGCAATAAATAGTA AGGGATTGAGAATGATAGT ATGACTGCCACTACTGAAGGCAAAATCACAAATAATAATGTTAGCTCAAGCCACTTTAAA AAAGATATCTTATTTCTTTCTATTTCTGTCCCCTTTCTTTCCATTTCTATCCCTCCCTCCTTAGCTATTTATAACCACAT ATCTAAAAAAAATCTATTAGCAACACAGACCAGCCTTTTGACA TAGATACTCACCACCTAGTCCACATGCAGTCGCTAC TCCTATTGAGATAATTAGTTGAAGTAGTTCATCACAAGAAGGTATACATATTACCACACAAATATCATAAATAATGGGAT CCTCAACAAATATTAAGCAAACTGTTCCACAAGCTTCGTCACATGCCACACTTTTAGCTACTCCTTCAGCTAATAGTCCA CATAATACTGAAACTATTGCTTTACATATTTCGCATTCTATCGGATTTGGATCTTTATCTTCTTCACTTTCACTCCTTTG TTGTAAAGGGTAAAGGCTGATACAGTTTATCTGGTATTAATATCTCCTTGTTCTCTATTCTTCTAGTTCTTATTCCACAA CCAGTTACGCCTTCTTTTATTAAGGCCCTATGCTTATCCCCTTCCTTTCCTAAATACCTAACTTTAAAAGTTCTTAGTAT ACTATCTTCACCGTAATTTATCCTATAAGTTATTTCATGTTCTCCAAAAGGGCGTTCAGTAATA