SSO9784

Coordinates:1935226-1935351

>SSO9784 42 aa !not a gene!
MVRRIGCCIDLSNSWQYCINSFANSWYNYFISSEYGRVLNWA

>SSO9784 42 aa !not a gene!
TTGGTACGTCGGATTGGCTGTTGCATCGATCTCAGTAACTCTTGGCAGTATTGCATCAATAGTTTTGCAAATTCATGGTA
TAATTACTTTATTAGCAGTGAGTATGGGAGGGTTCTTAACTGGGCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1934726 - 1935851 (Additional range around SSO9784 is :500nt.)

>Sulfolobus solfataricus P2 TTAATGTACCCTTAAGTTCAATCCTTTTTATCATATCAGCTTACGGGTATAGTATGGCTATTTTAGGTTTGTTAGCGGGT TTTCTATCAGCCAAGTTCACCACTAGAAGTGTTTTATTACTCTCATCTCTCCTATCGTTTATAGGACTTTTAGGTAGGGC AGTGTCCAATGGCTTTGGAACCTTCTTTCTTTTCGCCATAATCGCATCATTAGCTTATCCCTTAGCAGTAGCTCCAGTTG GCAGTATTGCTAAATCAGTTTTCAAAGGAAATGCTAATACTGTTGTCGGTATAAGCGTTGGCATTTTATTTATTGGAATG GCTCTAGGCTCGTTTATCAGTCCGTCAATACTTTCCTTTATAGGCTTAAGAGGAACATTAATGCTTAATGCGATTTTAGC TTTAATCGCTATGATTTTAATTATCCCATCTTTGAGGAGCTATCCTGCTCATTATGAAAGATCTCTTAAAGGTAGTTTCA ATCTAGGAATGGTAAAGAA TTGGTACGTCGGATTGGCTGTTGCATCGATCTCAGTAACTCTTGGCAGTATTGCATCAAT AGTTTTGCAAATTCATGGTATAATTACTTTATTAGCAGTGAGTATGGGAGGGTTCTTAACTGGGCT TAGTTTCCTAGGT TCTGGGCTTGGTGCTATAATATTGCCATCCCTACTGGAAAATAGGTTAAGGTTAGGTCTGATATCGGTTGGTTTGCTTAC ATCTCTCTCAGCGGTTATAACAGTATTATCCCTTTCCTTTACTATTAATTTCCCCCTAATAGCGATAGGGTATTTCCTAT TTGGGTTCTTTGGAAATGCCTATTGGTCAATGGCTATGGCTTCAACAACTCTATACGTTAATGATCCTGCAAAGGCTGGT TTCGCCACTTCCATGTATAGTGTAATAACAAATGTTGGAGTCTCAGTAATTCCAGAAACAGTTGGGGTATTATTTAGTAA TAATTCGACTATAATTGAGGGAGTCATAATAGTGGTTATAATTGAGCTCATAGCTGGTTTATTGTCATTTTTTCTAAAAA GCTAGATAAAAATACTTAAGATGGTGTCTCAGACGGAAATAATTGAATAATAATAATAGAAGAGAAATATAATTATATTT TTCAATA