SSO9789

Coordinates:1938215-1938397

>SSO9789 61 aa !not a gene!
MMSLYTAVSAAPLSPLVNTNAAKIMKATKRLKSLANVMLLTPNPSNNMSNATCIPTICNAM

>SSO9789 61 aa !not a gene!
ATGATGTCCTTATATACTGCAGTTAGCGCAGCTCCCCTTAGTCCACTTGTGAATACGAATGCAGCTAAGATTATGAAGGC
TACTAAAAGACTTAAATCACTTGCCAATGTAATGTTACTAACTCCCAATCCTAGCAATAATATGAGTAATGCTACTTGCA
TACCTACTATTTGTAATGCTATG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1937715 - 1938897 (Additional range around SSO9789 is :500nt.)

>Sulfolobus solfataricus P2 CAATTGCCATTATAGCTGCGGGGACTAATCCCCCTATGAAAATTCCTAACAATGCTATCCCAACAAACCAATCTGGCATT GAATAGCCTATTAGAGCAGGGACAGCTACTGCACCGGAGTGTGTTTTAGCAATAAAATTAACCACTTTAGAATTAGCGTA GACTAGAATTCCAAACAAGGCTATAACAGCTAATATGATAGAATAGAAGGGTTGTAATGCTAGTGATAATTTAAGGGATT TCTTAGAATCTGAACTCACGCTTGCATTAACCGCGTGGGGATATAGATAGAGGGCAAATGCGCTCCCGATAGCTAAAGAA ATATAAGCAGTTCGCGCAGCTAGGGTGTTAGGTAAATAGTTGTAGAAAATTGGCTTATTAACGTTATTTAACGCTAAGTT AATCTGGGAGCTTAACGTTTGGGCATTATGAAATGCACCAGAAAATCCTCCAAAGGCCAGTGGAACGTAGATCGCAATAC TTATTATTGTACCTAAAATT ATGATGTCCTTATATACTGCAGTTAGCGCAGCTCCCCTTAGTCCACTTGTGAATACGAA TGCAGCTAAGATTATGAAGGCTACTAAAAGACTTAAATCACTTGCCAATGTAATGTTACTAACTCCCAATCCTAGCAATA ATATGAGTAATGCTACTTGCATACCTACTATTTGTAATGCTATG TAAGGCAATTCAGCTACTACCCCTGTTATAGCTAC AAGCCCTGCTAGAATCCTACTGTTAAATCTATCCTTAATGAAATCCGCTGCTGTAACATACCCTCTGTTCTTAGCAATTG TCCACAGTCTAGGCATGAAGAGTAGGGCTATGAAGGGCGTGACCGCAGAGTAGAAGGCTGCAAAAAATCCAACTGGACCG CTGGCTAAGACTAGAGAAGGTACTGCAATAAATGTATATGCAGTATATAGGTCTGCAGTGAGAAGAAACCACATTAAATA TGGTCCTAATCTTCTCCCCGCTAAAGCCCATTCGTGAAGTTTCGATAGATCTCCTCTTCTCCATCTGCTTCCATAAAAGC CTAAAAACACAAAAATTACAAATAAAATTATAAACAGAGCAACTGAAACGATAGAAACGTGTAAACCATCCATGTTCTCA ATCCCTTATAACCATTACAATTGCTGTGAATACGAGAGCACCTATTGGCATTAGAATTATTTGA