SSO9806

Coordinates:1944484-1944705

>SSO9806 74 aa !not a gene!
MMDCRFSNLLPPLGGVTLRDIRGPRISSLFLFSSSCRVESPLLFLVPFLPRLIRSHLQRLRWSLPLLLCRLGRT

>SSO9806 74 aa !not a gene!
GTGATGGACTGTCGCTTCTCAAATCTGCTACCTCCACTAGGAGGGGTAACCTTAAGGGATATACGAGGTCCAAGGATCTC
ATCTTTATTCCTTTTCTCTTCCAGTTGTAGAGTAGAAAGCCCTCTGCTTTTTCTTGTTCCTTTTCTCCCACGGTTAATCC
GGTCTCATCTACAGCGACTACGTTGGTCTCTCCCTTTACTTCTCTGTAGATTGGGTAGAACT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1943984 - 1945205 (Additional range around SSO9806 is :500nt.)

>Sulfolobus solfataricus P2 TTACACGTGGACTTGAAGTTAAAGAGAAGATGATTCACTAGATTCCACGCAGAATCCAGAACCGTATAATAGAGGAACAA GAAGATCTTATTACTCAACTTCCTAACATACCTTATCCTTGCCTTCCTAACCTTAAAACCCTCCTCAACTTGCCACCTCA ACCTATAGAGTTCAGCCAGTTCATAGGGATCTCCCTCGAAGTTCGTTACGAACATGAAGTGCCTCGGCTTTCCCTTAACG TAAACCACATCGTAATAATAAAGCCCTTCAAATTCCAAGACCCTATACGCAACGTAAACCTTGTCCTTAACCTCATATCT CTTCTCAACTAATGGAACGTTAGATAGTTCCTTGAATCCCTTCAAGTTCGACTTTCCTCTCACAATGGTCTTCACGGGCA TTTCCTTGATGACCCCTAGGTTCAAGAATCCGGCGTCAGCTACAACGTAATCTATTTCCATGTATTGGCTTACTTCCCTC ACGCTCCTGAGTAGGAACT GTGATGGACTGTCGCTTCTCAAATCTGCTACCTCCACTAGGAGGGGTAACCTTAAGGGAT ATACGAGGTCCAAGGATCTCATCTTTATTCCTTTTCTCTTCCAGTTGTAGAGTAGAAAGCCCTCTGCTTTTTCTTGTTCC TTTTCTCCCACGGTTAATCCGGTCTCATCTACAGCGACTACGTTGGTCTCTCCCTTTACTTCTCTGTAGATTGGGTAGAA CT TGAAGGTTCTCTGACCTTTACTAATTACTTTCTCGCCTTGTCTTACTACCTTCAAGTAGTATTTTCCTCTGTTTCCG GTTAGCAAGGATGGTGCTGCTTTCACTATTTCCGGGTCTAGATCTTGAGAGATAACGTTAATATTGTTTGTTGCTAAAGT TATAGCGAGGGACTTCAGCTCCGTTTTGGGTAATATCATGGTTTGCATAACGGAGTTATGGAGTCCCTCGCTTTAACCTT TTCTTGTTCATCTCGTCCTTCCACCTACTTTCCTCTATTGATAATACTAGACAAATGGTATTACTCTTTATATATAAACT CGTTTTCTGTTAGTTTCTTCAACAAATATGAAAATTTTTTGCTTCTTGTGTTGAAATAAGCCGATTTTTCTAACTCCGCT CTGATATTTTTCTCTTCCATAGAAATTGTATCATTTTGAGTAAAATTGGTGAAACACCACTGCTTTAAACTATTTTCTAC AGATTTCTCTTCCTAGAAAGCCT