SSO9816

Coordinates:1946605-1946766

>SSO9816 54 aa !not a gene!
MLALLERRISLTHCRKLPLTQSINFLPLRSIYCYTSLSLSSLTLVHLLPCLVNL

>SSO9816 54 aa !not a gene!
TTGTTGGCATTATTAGAGCGTCGTATTTCCTTAACGCACTGTCGTAAGCTTCCTTTAACACAATCGATAAATTTCTTGCC
TTTGCGTAGTATCTATTGTTATACATCTTTATCATTAAGTAGCCTAACATTAGTACACCTTTTACCGTGTTTGGTAAATC
TC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1946105 - 1947266 (Additional range around SSO9816 is :500nt.)

>Sulfolobus solfataricus P2 GTAGTGAGATTAATTCTGTACTATCCGATGGAGATAGGAAGAAATATTGATGAAATTCTTAGAGCTATTAGAGCACTACA ATTAGTTGACAAAGCAGGAGTAGTAACTCCAGCTAACTGGCCTAATAATGAACTAATAGGAGATAAGGTCATTAATCCAG CTCCTAGAACGATAAAAGATGCAAAGATGAGATTAGGTCAGCCCTTTGATTGGTGGTTCACTTATAAAGAAGTTAAAACA ACATAACATGAATGGGTAAAATTAAATTTATTTTTTGATTCTCTCAAATACATTAGCTAATTTTAGAACCTTGTCTTCTT CAAAATGCCTTCCTATTATCATCAGACCGACTGGTAAACCATTCGAATATCCCACTGGTATATTCATAGCAGGGTGTCCA GTAACGTCAAAAGGAGCTGTATTATTTATCATTCCGAGCGCCATTATAAAATATTCATCAAAGCCTGGTTCACTCTTATA CCTCATTGCTTTCATAGGAG TTGTTGGCATTATTAGAGCGTCGTATTTCCTTAACGCACTGTCGTAAGCTTCCTTTAAC ACAATCGATAAATTTCTTGCCTTTGCGTAGTATCTATTGTTATACATCTTTATCATTAAGTAGCCTAACATTAGTACACC TTTTACCGTGTTTGGTAAATCTC TAGCTCTGGATTTTAAGGAGTTCCCAAAGAAATCTGCAATTTGAGTCTCAAATAAG CCCTTCCTTCCCCATCCTACACCACTTCCTAATATCATGGTTGCTGTGGCACCCTCAATAGCTATTGGAGTCCATATATC CAATCCCATCCTATGAAGAGGTATGGAGGTATCCTCTACTTTTATTCCATAATCTTCTAGTTTCTTGGCAGAATCTAATA CTAACTCATCAACATCCTTTTCAGAATTGGACCAATTAAATCCTTCCTTAACTATGCCAACTTTCATATCTTTTACGTCG CCATCAATAAGTTTAGAATAGGGTTTGACTGGAGGTGGAGGTAGGCTATCTGGCTGTCTTGAATCCAATTCATCCCTCCC TGCTATTACCTCTAAAAGTAATGCTACATCCTTTACCGTATTAGCCATAGGTCCTAGATGATCTAATGTAGGCTCTATGG AAAAAGCGCCGGTATATGGAACTAGTCCATGAGTTGGTTTTAG