SSO9821

Coordinates:1949019-1949141

>SSO9821 41 aa !not a gene!
MGQTKTRSDRDKSFFTYPHLAQVLEVYAGLTRMSFFPYFSS

>SSO9821 41 aa !not a gene!
TTGGGACAAACGAAAACACGATCAGATAGAGACAAGTCATTTTTCACATACCCGCACCTAGCACAAGTTTTGGAAGTGTA
TGCAGGATTAACTAGGATGAGTTTCTTTCCGTATTTTTCCAGC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1948519 - 1949641 (Additional range around SSO9821 is :500nt.)

>Sulfolobus solfataricus P2 CACTTAGGACAAGAGATGGACGAATAATATAGGATATTGTAGATTTCGTATAGTAGTTTTAGGAAATTCCCTTATCATAA AAAGTCAAAATATTTATCCATGTATTTATAAATATCTTTCATTGTACTTCTTAATATTATAGCTCATCAATAAACATTTC TCATCTAATCAGGAAAGATTTATTATATATTTTTAACGTAACGTAAAAGTGTAACGATTTTCCGATAAATCCTATTCGTA GAGCCGAAGATGATGATGATACATATTAGCTAACAAAAGTTATTCTCATAGGTATATGAGGAGTAACCCTCTATAAGGAT GATTAAGTGCGGAAGTGAGCTACCCCCTCATAAATGAGGGAGCTTCCTGCTTCACAGCTCTGCCATGCCAGAGTACTGGT AGAGGGCGGAGCTCCACAGGCACTAAGGATCGCTCCGACCCCGCACTCTTCAAAATGTTAAGAGAAGCATTATAGTCACG ATCTGCAATCCAACCACAG TTGGGACAAACGAAAACACGATCAGATAGAGACAAGTCATTTTTCACATACCCGCACCTA GCACAAGTTTTGGAAGTGTATGCAGGATTAACTAGGATGAGTTTCTTTCCGTATTTTTCCAGC TGATACTTCAGCACAT CCCTCAGCTCACCAAATCCCACGTCACTCAGCCTCCTCCTCAGAGACCTCAAGGACTTACCCACACAAGTTGTTTAGCGT GAATACCCTCCATCACCACAACGTCATAATGCTCAGCAAACCACTTACCCAACTTCATGTAAAGATCCGTTCTTAGATTC TTCAAATGCTCATAAGCCCTAGCAAGCTTAACCTTAGCCTTAAACCAATTATGAGAGAGGAACTTCTTCCTTGAAAGTTC TCTGTGTAGATGCTTCACTTTCCATAACGCCTTTTCAAGAGGTCTCAGATTGGGGAAATATTCACCATCTGACGTTACTA ACAACTTTTCTACACCAACATCTATCGCCACTTCCTTACCAGTGTTAGGTAACTTGGGGAATTCGTGATCAACTACGAAA GTGATGTATATCCTCTCAGATCTTGTTAGCTTCACTATCACCCTCTTTACTTTGTCAAGGGGAAAGTCCCTGTGTATAAT TACC