SSO9822

Coordinates:1949169-1949306

>SSO9822 46 aa !not a gene!
MSYPLINEGASCFTALPCQSTGRGRSSTGTKDRSDPALFKMLREAL

>SSO9822 46 aa !not a gene!
GTGAGCTACCCCCTCATAAATGAGGGAGCTTCCTGCTTCACAGCTCTGCCATGCCAGAGTACTGGTAGAGGGCGGAGCTC
CACAGGCACTAAGGATCGCTCCGACCCCGCACTCTTCAAAATGTTAAGAGAAGCATTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1948669 - 1949806 (Additional range around SSO9822 is :500nt.)

>Sulfolobus solfataricus P2 CGGTTCCCCTCATCGATTCGGAACTACATCTCTCATTTGAGGGGCAGTCGAGAGGGTCAGAGACCCCTCCCATTCTAATT AACTATAGCAATAACGTCGCGGTCATTCTCATAACCGCAAGAGCATTTAAACCAACGATATAAAACCTCAACCATATTAC TACCACACTTAGGACAAGAGATGGACGAATAATATAGGATATTGTAGATTTCGTATAGTAGTTTTAGGAAATTCCCTTAT CATAAAAAGTCAAAATATTTATCCATGTATTTATAAATATCTTTCATTGTACTTCTTAATATTATAGCTCATCAATAAAC ATTTCTCATCTAATCAGGAAAGATTTATTATATATTTTTAACGTAACGTAAAAGTGTAACGATTTTCCGATAAATCCTAT TCGTAGAGCCGAAGATGATGATGATACATATTAGCTAACAAAAGTTATTCTCATAGGTATATGAGGAGTAACCCTCTATA AGGATGATTAAGTGCGGAA GTGAGCTACCCCCTCATAAATGAGGGAGCTTCCTGCTTCACAGCTCTGCCATGCCAGAGT ACTGGTAGAGGGCGGAGCTCCACAGGCACTAAGGATCGCTCCGACCCCGCACTCTTCAAAATGTTAAGAGAAGCATTA T AGTCACGATCTGCAATCCAACCACAGTTGGGACAAACGAAAACACGATCAGATAGAGACAAGTCATTTTTCACATACCCG CACCTAGCACAAGTTTTGGAAGTGTATGCAGGATTAACTAGGATGAGTTTCTTTCCGTATTTTTCCAGCTGATACTTCAG CACATCCCTCAGCTCACCAAATCCCACGTCACTCAGCCTCCTCCTCAGAGACCTCAAGGACTTACCCACACAAGTTGTTT AGCGTGAATACCCTCCATCACCACAACGTCATAATGCTCAGCAAACCACTTACCCAACTTCATGTAAAGATCCGTTCTTA GATTCTTCAAATGCTCATAAGCCCTAGCAAGCTTAACCTTAGCCTTAAACCAATTATGAGAGAGGAACTTCTTCCTTGAA AGTTCTCTGTGTAGATGCTTCACTTTCCATAACGCCTTTTCAAGAGGTCTCAGATTGGGGAAATATTCACCATCTGACGT TACTAACAACTTTTCTACA