SSO9828

Coordinates:1952568-1952696

>SSO9828 43 aa !not a gene!
MDNYFSSFKGFAKNYGRSYKEVFSSILGRDINWYFCGWACICI

>SSO9828 43 aa !not a gene!
ATGGATAATTATTTCTCTAGTTTTAAGGGCTTCGCCAAGAATTATGGGAGAAGCTATAAAGAGGTCTTTTCATCAATACT
GGGGAGGGATATTAACTGGTATTTTTGTGGTTGGGCTTGCATATGTATT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1952068 - 1953196 (Additional range around SSO9828 is :500nt.)

>Sulfolobus solfataricus P2 TCATCTTCAGTTGCGAAAGTAGTGGCAATTTTGGCTCTATTACCACCTTGGATATTATTATATCTAGTTGATAAATGGAG GGGGATAAGAGAAGCATGGCCAATAGCTATACTTGGTTCACTATCCTATATTTTAGGTCAATATCCAGTAGCGAGTTTTA TTGGTCCTTATTTACCGGACATTACAGGATCTTTAATATCTTTCGTCATATTACTTTTATTCTTAAGAGTGTGGAGACCT AAGAGAGTGCTGAGTCTAAGAAGCGTTCAGCCTAATGGTGGGGAGAGCAAGAAATACTCAACAAAAGACGTTATTGAGGC CTTATCAGCCTTCATAGTGTTAATTATAGTAGTAACTCTATGGACTGGTCCTTGGTCACCACTAACTAAGTTTTCATTAG TAACCTTATCTCAAACAGCATACTCCTCTCTTCTCCATAAAAATGTAGGAGTAAGTTTTGCATTCAATCCTTTCGTAGCG GGTACGTCAATTTTAGTATC ATGGATAATTATTTCTCTAGTTTTAAGGGCTTCGCCAAGAATTATGGGAGAAGCTATAA AGAGGTCTTTTCATCAATACTGGGGAGGGATATTAACTGGTATTTTTGTGGTTGGGCTTGCATATGTATT TAATTTCAG CGGAATGGCTTACTCATTAGCTTGGAAAACTAGTGACCTAGGTATAGCATTTATAATAGTTTCACCCTTATTTGGTTGGA TTGGATGCGCATTATCAGGGAGTAATACGTCGACCAACGCCCTTTTTGGGGCGTTTCAAGTTACAACTGCACGTTTAACT GGTTTGCCCGTAGGATTACCACCAGCGTTAAATTCTGTGGGTGCTGAGTTAGCTAAACCAGTTGCTCCACAGACTGCTAG TGCAGGAGTATCCACAACAAAATACGTTCGAAAAGAGGGTATAGTGATTAGGAAAAATCTACCTTGGGCTATAGGCATTT TGATATATCTAATACTTATAGGAGTACTATACGCATTCTTAGCTCCATCTCTATTTGTACATTAGTGTTAGATATATGAA TTAACTTCCTTTTTTCTATTAAGTTAACTCCTAATGTTTTTACATCTCTAGGATTGTTTAACTTAAATTATTCTTCTCAA AGTTTCAAGT