SSO9837

Coordinates:1956401-1956598

>SSO9837 66 aa !not a gene!
MVVIPFDPQLSYKLVMQYRKPLEQYLPKPIANPRLSPLMRHYVQLHRLQDHLKLYFLLLRLLEHDL

>SSO9837 66 aa !not a gene!
ATGGTAGTAATACCCTTTGATCCTCAGCTATCCTATAAGCTAGTAATGCAGTATCGAAAGCCTCTTGAGCAGTATCTACC
CAAACCAATAGCCAACCCACGTCTCTCACCATTAATGCGTCATTATGTTCAACTCCATAGGCTCCAGGATCATCTAAAGC
TCTATTTCCTATTATTGCGACTACTGGAGCACGATCTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1955901 - 1957098 (Additional range around SSO9837 is :500nt.)

>Sulfolobus solfataricus P2 ACACACACTACTCTAGAATTAGCTAAATACCTAATAACATCTTGTGTTGGGAATGGCCTGAACCATCTTATCCTTAACAT TCCCACCTTATAGCCTTGCCGTCTCATATTCTTTATTGCGACCTTCATCGGTTTAGATACTGTTCCCATTCCAATTAGCA CTACCTCTGCGTCATCAATCATATACGGTTCTACAAATGGGTTTTCTGGCATCTGTAAATCGCTAGTTGAGCCGGGATAT CTTCCAAATACCTTTTTAAATTCTTCATAAGCCTCAACTATTACACTTCTAGCCCTCTCCATGGCCTCTTCGTGTTGTCT TCTTATTTCCATAACCCAATCCTCATTAACTTGAGGAGCTACCGTAATCGGATTATCAGGGTGAACCAAGTACTTACCTC TATTATATGGTGGTAAGAAGTTCTTAACTAGTTCTCTAGGAGGCAATCTTACTATCTGTTCCGAGTGTGTTAGAAATCCA CCATCCATAGAGATACCTA ATGGTAGTAATACCCTTTGATCCTCAGCTATCCTATAAGCTAGTAATGCAGTATCGAAAG CCTCTTGAGCAGTATCTACCCAAACCAATAGCCAACCCACGTCTCTCACCATTAATGCGTCATTATGTTCAACTCCATAG GCTCCAGGATCATCTAAAGCTCTATTTCCTATTATTGCGACTACTGGAGCACGATCTG TAGCAGTAACTACTATTGCTT CCATTGCGTAAAGCCAACCCACTCCACTACTCCCCACTAGAGTCCTTGCCCCCGCTAATGATGCGTGCTTCACGGTCTCA AACTGTCCATGTTCTCCCTCAGCAACTATGAACTCCGCATCTAATTCTCCATCGGCTATTAATTTGGAAATCGTATCCAT AACTTCAGTATATGGTCTAATTGGATATGCAGCAACAACGTCTACATCGGCGTACATTGCTGCATGAGCTACTGCTTGTG TTCCATTCATTAATACCTCTCTTTCTACTAATTTCTTAACCTCAGTCATCTTCCCAACCCCGGAACGTAAACTCTTTCCT TCCTAGCTTGCCTTACAGTTTTTAACCATTCCTTATACTTTGCTTTATCCTCTTTCCACATCTCATATGGCCTTCTGTAA TCCGTGAACATCGATTCGTCTACCATTACTATGCAATCCTTAACTGGGCACACTTCAGCGCATATTCCGCATCCTACAC