SSO9840

Coordinates:1958642-1958827

>SSO9840 62 aa !not a gene!
MEYGTVSISITNETFKPKFTLSIKATYPLIICASSNLLILYLTVLIGIPSSSDSSFKLFLAL

>SSO9840 62 aa !not a gene!
ATGGAGTATGGTACTGTCTCTATTTCCATTACTAATGAGACATTCAAACCTAAATTTACTCTGTCTATTAAGGCGACATA
CCCTCTTATTATTTGCGCATCTTCCAATCTCTTAATCCTATACCTTACTGTACTTATTGGTATTCCGAGCTCATCGGATA
GCTCCTTTAAACTCTTTTTAGCATTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1958142 - 1959327 (Additional range around SSO9840 is :500nt.)

>Sulfolobus solfataricus P2 TGAATATATAGATGGAGAGATAGTGTACAATGAGCCTACCAAGAGCATAGTAGAGGGTAGAATGAAGAGAAAACCAGTAA AAGAGTACTTAGAAAAGCAAGGAAGATTTTCACATTTTACTGAAGAAGACATTGAATACGTCCAAAGAATGGTTGACGAG ATGTATGAAGAATGGGAAATACCTGGGGTAATGCCAATAAAGTCAATAAATGCGAAGATAAGTGATAAATAAAGAAAAAT ATCTTTTCTTTTTTCCTATTTTTGGAAATTTATATTGATGTACTCATAACAGTACTGAAGGATCTATCTTATATCTCTCA ATTATCCTTGAAATCGAAACAGTCTTGATTCCCTTAATATTGTACAATTTATTGGCTATAAATTGATGTGCGCTTGCATC ATCTTTAAAGATCATATGTACATGTAATCTAGGCCCATTATCTAAACCGTATATCCTCACTACTTCCGGTATTTCACCTA GGTCTTGGGCTACCTTCTTT ATGGAGTATGGTACTGTCTCTATTTCCATTACTAATGAGACATTCAAACCTAAATTTAC TCTGTCTATTAAGGCGACATACCCTCTTATTATTTGCGCATCTTCCAATCTCTTAATCCTATACCTTACTGTACTTATTG GTATTCCGAGCTCATCGGATAGCTCCTTTAAACTCTTTTTAGCATTA TAGCGCAAAATGTTAAGAATTTTCTCATCAGT ATCATCAAGTCTTATTATATTTACTCCCATCATTATACATTATACATTATCAAACATAAAAGGATTATTGTAAAAATTAC AAGATAATGCCTTTTTATATTGCATAAAATGAAGTTTTATATCGCTTTGTTTGATAATTTTGCAACCCTAGATAGGTAAA GAATTATTAAAGTTTTAAATATTTATCATACTTCGTCAGACTTTAAAGGGCAAGAAAACTTCACTCAGTATTGACGTCCA AGGTTCACCGCACCTCTTCACACTATACGTAAGGTCATTTACTCTCTTGGATATGGAGCGTAGGAACCTCGTTGCATCCC ACATTAAGGTCTCGAAGTCCGTGTAAATCTTCGAGTAGAGCCTTTTCTTGAGGACTGCCCACGGCCCCTCCGCCGGACTC TTATCCGGAGAGTAAGGCGGCAGATAAACAAACTCCACCCCATTTTCCTCAAGGAATTCCCTCACTT