SSO9849

Coordinates:1961633-1961758

>SSO9849 42 aa !not a gene!
MDPSMVHLTRQMLVRNRHHQYPVHLRLMARCHPMHLLLLNHL

>SSO9849 42 aa !not a gene!
ATGGATCCCAGTATGGTGCACCTAACCCGACAAATGCTGGTACGAAATAGACACCACCAGTATCCGGTACACTTGCGGCT
AATGGCTCGATGTCATCCGATGCATCTATTGCTCTTAAACCATCTC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1961133 - 1962258 (Additional range around SSO9849 is :500nt.)

>Sulfolobus solfataricus P2 TATGGAACCTCTATATGAAAAATGTCATAAACGGGTTCTGGTCAAAGACTGAATGACCATAGTTATTTACTACCTAACGA TTTTTCCCAACCCAGCGACCTCTTCACTGCCTCTTTCCACGCATTATAGCGTCTTTCCCTTTCTTCTTTATTGATTGAGG GAATGAACTCTTTGTCGACAGTCCATTTTTGTTTCAATTCGTTAAGTGAATTCCAATAATTTATTGCTAAACCTGCTAAC ATTGCAACGCCCATAGATGCAGTCTCCATTACCTTCGGCCTTACTACCCTAATTCCCAAAATATCTGCTTGAAATTGCAT CAGTAAATTGTCCTTAGCCCCACCACCATCAACCTTTAGTATGTTTATCTTAGTCCCAGACTCTTTCTCCATTATTTCTA TTACGTCTCTATTTTGGTATGCTATTGATTCGAGTATTGCTCTAGCTATATGAGCCTTTGTAGTCCCCCTCGTAATACCT ATTATCAATCCCCTCGCGT ATGGATCCCAGTATGGTGCACCTAACCCGACAAATGCTGGTACGAAATAGACACCACCAG TATCCGGTACACTTGCGGCTAATGGCTCGATGTCATCCGATGCATCTATTGCTCTTAAACCATCTC TAAACCACTGTAC TGCCGCACCAGTTATGAATATACTTCCTTCTAAAGCATATGTAACCCTTTTACTCTCTAAACCCCAAGCTATAGTGGTTA GTAAATTTTCTGAAAAAATCGGATTGCTACCTATATTCATCAGAATGAAACTTCCAGTCCCATAGGTTGATTTTACTTCG CCCATGTCATAGGCTACTTGACCAAACAAGGCAGCTTGTTGATCTCCGGCATCACCAGAGATTGGAATAGAGGATCCCAA AACTTCAGTATACCCGTAAATATCGCTAGATGGTCTCACTTCAGGTAATATACTCTCTGGAATTTTCAATAATTCCAAGA TTTCTCTATCCCATTCTAGCTTATTTATGTTGAATAGCATGGTTCTTGACGCGTTTGAATAATCAGTTACGTGAATCTTA CCATTAGTTAACTTCCATATAAGATAAGTATCTATAGTTCCAAACTTTATTTCGCCCTTTTCTGCCTTACTCCTCACATT AGGGAGA