SSO9855

Coordinates:1963677-1963820

>SSO9855 48 aa !not a gene!
MQLKYQKLKRRKDQVPLFYFYPSYLITIQTLLIQVSYRLVTLLVVSRT

>SSO9855 48 aa !not a gene!
TTGCAGTTAAAATACCAAAAACTAAAAAGAAGAAAAGATCAAGTCCCATTATTTTACTTCTACCCATCTTATCTGATAAC
CATCCAAACACTATTGATCCAGGTATCATACCGATTAGTGACGCTGCTAGTAGTAAGCCGTACT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1963177 - 1964320 (Additional range around SSO9855 is :500nt.)

>Sulfolobus solfataricus P2 TGACGGAAATGCAAATTCCTCAAGTAAAGCTGGATAATATAATCCAATTCCGTAAGCTGCGACGTCAAATAAAAACCAGA CACTAGTTACAAAAAATGTAATTTTTAGTAATTTCCCTTTAAATAAATCAACCACGCCTCTAACTCCCTTATTCTCTATT TCCCTATTTATTTCCTTAATATTGGCCTTTCCAGTAGAAACGAGCCATCTTGGAGACTCAATTAATCTAAGCCTCAGGAG AATTATTGGTACCGATATTAAGGCACCTATAAGGAATACGTACCTCCAGAAGTAACTCCCAGTAGGTAATAAAAATAGCG TCGCAATCCCTGATATTGCAACACCAACCCAATACATAGCTACTGATCCAGTCAAATATCTTCCCCTAGATCTAGAAGGT GAGAGCTCAGACATTAATGTGCTGCTTATTGGATAGTCTCCCCCTATTCCTATTCCCAATAATAACCTTGAGATGAAAAG TTCGACAAAATTTTGGGAAA TTGCAGTTAAAATACCAAAAACTAAAAAGAAGAAAAGATCAAGTCCCATTATTTTACTT CTACCCATCTTATCTGATAACCATCCAAACACTATTGATCCAGGTATCATACCGATTAGTGACGCTGCTAGTAGTAAGCC GTACT TAACTGTTGTTAAGGAAAACTCCTTCAATATTATTGTGGCTGCAAATGATATTGAGTTTAGATCATAACCATCT AGTAAAAACCCCGCAGAAGTTACTATGAATGTCCTAATTCTTACTGATAGCGGTATGTTGTCGAAGTAGCTCATTAATAT TATTTCGTTATTTTATAAAATAAAAGTGTTTCTATGAGAAAAAGATTTTACTTCGAGAGGTATTTCCAAGACAGTACTAT ACCTATTGTAGATAATATTATGGCAAATAATCCTAGATAGAGAAAGTCTATAGCAAGATTAGTACTTATTCCCAGTAACA TCCCTCTCGCAACCCCATTAGAATACGTTAATGGATTAATGTAGGCTACTGGCTTTAACCAATACGGCATTGATTTTACT GGATAGAATGCGTTGCTGGTAAAGAGTAATGGTAGGTTTAGTAAATTCATTATAGCCATTTGTGATTCCCAACTAGTAGC TCTCAGAGCTAGCATTAGAAATAAT