SSO9859

Coordinates:1964837-1964959

>SSO9859 41 aa !not a gene!
MLKSTNRGKQNSYFFLPLSCSGPPHSSSKRKHFLSTCLFIS

>SSO9859 41 aa !not a gene!
ATGCTAAAGTCCACAAACCGTGGAAAACAGAATAGTTATTTCTTTCTTCCTCTATCATGTTCTGGCCCTCCTCATAGTTC
TTCTAAACGCAAACATTTCTTGAGCACTTGCCTCTTCATCTCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1964337 - 1965459 (Additional range around SSO9859 is :500nt.)

>Sulfolobus solfataricus P2 CATTAGGAACAATGCAGCGTAGACTCCTAGGAAGTCAAGAGGGTTAATTTCTGGTGCAAAAGTCATTCCGAGCAGTACTG CAACTACAAGGACAATTGTAGCTTGCACTAATGATCTTATTACCGCAGAAAGTACCTTACCTATTATTATGTTTCCTCTA GGAACTGGGGTAGTTAGAATTCTATCAAGTACTCCTAATCTTCTATCCCAAACTATTGACATACCACTCTGCATTGATGT AAATAACACTATGAAAGATAGCATCCCTGCAGCTAGGAAGGAGAAGTAATCAGTAGTTCCGAAGGTCTGTTTAAGTATCT CTAAACCTATTTGGTCTAATACTTGCTTTGGTATTGTTAAACCAGGTATATTAAAGGTGGTTTCTGTGAAGATACTGCCT AAATTCATTGCCTTACCGAATATTCCTATCCAGAATATTGGCTGTATTAATGAAAGGAGGAGTATTACGGGTGCCTTATA CCACTTCTTCAGTTCCCTAG ATGCTAAAGTCCACAAACCGTGGAAAACAGAATAGTTATTTCTTTCTTCCTCTATCATG TTCTGGCCCTCCTCATAGTTCTTCTAAACGCAAACATTTCTTGAGCACTTGCCTCTTCATCTCT TAGGCTCTTTCCAGT AAACTCCATGTACACTTCATCCATAGTGGGTTCAGTTATTGACATTCTACTGACCTTAATTCCATTCTTAACCAGAGATT CCAATATCTCGGGGGCTTTCTCCTCACCATTTCTAACCTTAATTCTAATACCATCACTAGCTTTTCTCACATCCAAGATG CCATCCTTTGATGAAGATATTATCTTAATGGCTAGTTCATCATTACTGGTTTGAAGCGAAACCACATCTCCACCAACCTT TTCCTTCAATTCCTTAGGGCTTCCTATTGCCAAGATCTTTCCTTTATCAATGATCGCAATTCTATCTCCGTACATATCCG CCTCTTCTAAATAATGTGTTGTCACGAAAATTGTCATTTTGTATTCCTCCTTGAGTTTCATTATGTATTGCCATATTGCG GCCCTTGTTTGTGCATCTAAACCTAACGTTGGTTCGTCTAAGAACAATATTCTAGGCCTACTTATTAGCGACATTGCAAT TTCT