SSO9861

Coordinates:1964982-1965185

>SSO9861 68 aa !not a gene!
MYTSSIVGSVIDILLTLIPFLTRDSNISGAFSSPFLTLILIPSLAFLTSKMPSFDEDIILMASSSLLV

>SSO9861 68 aa !not a gene!
ATGTACACTTCATCCATAGTGGGTTCAGTTATTGACATTCTACTGACCTTAATTCCATTCTTAACCAGAGATTCCAATAT
CTCGGGGGCTTTCTCCTCACCATTTCTAACCTTAATTCTAATACCATCACTAGCTTTTCTCACATCCAAGATGCCATCCT
TTGATGAAGATATTATCTTAATGGCTAGTTCATCATTACTGGTT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1964482 - 1965685 (Additional range around SSO9861 is :500nt.)

>Sulfolobus solfataricus P2 ATTATGTTTCCTCTAGGAACTGGGGTAGTTAGAATTCTATCAAGTACTCCTAATCTTCTATCCCAAACTATTGACATACC ACTCTGCATTGATGTAAATAACACTATGAAAGATAGCATCCCTGCAGCTAGGAAGGAGAAGTAATCAGTAGTTCCGAAGG TCTGTTTAAGTATCTCTAAACCTATTTGGTCTAATACTTGCTTTGGTATTGTTAAACCAGGTATATTAAAGGTGGTTTCT GTGAAGATACTGCCTAAATTCATTGCCTTACCGAATATTCCTATCCAGAATATTGGCTGTATTAATGAAAGGAGGAGTAT TACGGGTGCCTTATACCACTTCTTCAGTTCCCTAGATGCTAAAGTCCACAAACCGTGGAAAACAGAATAGTTATTTCTTT CTTCCTCTATCATGTTCTGGCCCTCCTCATAGTTCTTCTAAACGCAAACATTTCTTGAGCACTTGCCTCTTCATCTCTTA GGCTCTTTCCAGTAAACTCC ATGTACACTTCATCCATAGTGGGTTCAGTTATTGACATTCTACTGACCTTAATTCCATT CTTAACCAGAGATTCCAATATCTCGGGGGCTTTCTCCTCACCATTTCTAACCTTAATTCTAATACCATCACTAGCTTTTC TCACATCCAAGATGCCATCCTTTGATGAAGATATTATCTTAATGGCTAGTTCATCATTACTGGTT TGAAGCGAAACCAC ATCTCCACCAACCTTTTCCTTCAATTCCTTAGGGCTTCCTATTGCCAAGATCTTTCCTTTATCAATGATCGCAATTCTAT CTCCGTACATATCCGCCTCTTCTAAATAATGTGTTGTCACGAAAATTGTCATTTTGTATTCCTCCTTGAGTTTCATTATG TATTGCCATATTGCGGCCCTTGTTTGTGCATCTAAACCTAACGTTGGTTCGTCTAAGAACAATATTCTAGGCCTACTTAT TAGCGACATTGCAATTTCTAATCTCCTCCTCATTCCACCAGAGTATGTCTCCACTTTTCTCTTAGCTGCATAGGTTAACT CAACCATCTCAAGTAACTCCTTAGCTCTCTCCTCTGCTATTCTTTTCGGAATTCCATAAAGTCCTGCCATCATCATCATG TTTTCCCAACCGGTTAAGTCTTCATCTGCTGTGTATTCTTGCGGAACTACACCAATTGATTGTCTAACTAATGCAGGCTG TTTTA