SSO9878

Coordinates:1970531-1970656

>SSO9878 42 aa !not a gene!
MSNNNSLFISSLLFIVYRQLTKSLSKLITFISTNVEMFNLAL

>SSO9878 42 aa !not a gene!
TTGTCAAATAATAATTCTCTTTTTATTTCAAGTCTTTTATTTATAGTTTATCGTCAATTAACAAAATCGTTGTCCAAACT
CATTACCTTTATTTCAACTAATGTTGAGATGTTCAATTTAGCTTTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1970031 - 1971156 (Additional range around SSO9878 is :500nt.)

>Sulfolobus solfataricus P2 GAGCTCCGCCCTCTACCAGTACCAGCACTTCGGTACTGGCATGGCAGAGCTGTGAAGCAGGAAGCTCCCTCATTTATGAG GGGGTAGCTCACCACGTCTATAATAAGTACGATAGTGATGAGGTTTCTATCAAAAATAATAGATATAAAATCCTCACTCC ATAGTATAGTAATTATGGAAAATAAAAATACCCTAAAAGAAGTTGAAGACTTCTTAAGGGCAAAAACTAACATATTTAAG GTTAGGAGTTATGTCTACGAGGGAATAATTAAAGTAGATGAATACATCTATAAGGACTTAAAAATAGAACTTTTCTACTG CGATGAAAAATTACGACATATTATAATAAAGAGTAGTGATTTAAATAAGACCTTCAATAACGATGAATCAACCCAGAATA TAGCGGAAATTATAGAATATATAGAAGATAAGTTGAAGAAATAACTTTTTAGGCCTTATAAAAGGATCCAAACACTCTCA TTCGAGACTTGTCTTCATT TTGTCAAATAATAATTCTCTTTTTATTTCAAGTCTTTTATTTATAGTTTATCGTCAATTA ACAAAATCGTTGTCCAAACTCATTACCTTTATTTCAACTAATGTTGAGATGTTCAATTTAGCTTTG TGATCCTTCTAAC TCTTCTGGAAAATTCAACAAGTTCACAAACCGTTGGTATTTTGGAAAAGTTCTTAGACTATGATCTAGTGGTATATCCTT TGCCTAAAGCTATAAACTTTCTGAAAGCATTAGTGTTATAAAAAGATATTAATATATATATTGCAAATACAATTCCACTA TATGGAGTACTCAGAACTAATAAAGCTGTTAGAGGAAACGGTAAGAATTCCATTTTATGCCATATTAGGTAAGTTAAAGA ATAATTTAATATATTTGGCAACATCTGAGGGAGAAATAAGCATCTATGCTCTAATAGGTGGAAAGAATGTAAAGTTAACA AAATCGCCAATAGCAATTTCAACTAGACCAAAATCAAGCCTAGACTTTATACCCTTTGCAAGAGACGTTGAAAAGGGGAA AGAAATTCATGCAATACATATAGCAAATTTGAAAGGAGAGGAATTTCAGATTGAATCGCCAAGGGTTAGAATTTCATCAC TGACCTA