SSO9887

Coordinates:1973049-1973195

>SSO9887 49 aa !not a gene!
MYWLTSLTLLSRNCDGLSLLKSATSTRRGNLKGYTRSKDLIFTPFLFQL

>SSO9887 49 aa !not a gene!
ATGTATTGGCTTACTTCCCTCACGCTCCTGAGTAGGAACTGTGATGGACTGTCGCTTCTCAAATCTGCTACCTCCACTAG
GAGGGGTAACCTTAAGGGATATACGAGGTCCAAGGATCTCATCTTTACTCCTTTTCTCTTCCAGTTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1972549 - 1973695 (Additional range around SSO9887 is :500nt.)

>Sulfolobus solfataricus P2 TTAGAGAAGCTTGACGAATGAATCGAAGGACAAAACCTTCTTACACGTGGACTTGAAGTTAAAGAGAAGATGATTCACTA GATTCCACGCAGAATCCAGAACCGTATAATAGAGGAACAAGAAGATCTTATTACTCAACTTCCTAACATACCTTATCCTT GCCTTCCTAACCTTAAAACCCTCCTCAACCTGCCACCTCAACCTATAGAGTTCAGCCAGTTCATAGGGATCTCCCTCGAA GTTCGTTACGAACATGAAGTGCCTCGGCTTTCCCTTAACGTAAACCACATCGTAATAATAAAGCCCTTCAAATTCCAAGA CCCTATACGCAACGTAAACCTTGTCCTTAACCTCGTATCTCTTCTCAACTAATGGAACGTTAGATAGTTCCTTGAATCCC TTCAAGTTCGACTTTCCTCTCACAATGGTCTTCACGGGCATTTCCTTGATGACCCCTAGGTTCAAGAATCCGGCGTCAGC TACAACGTAATCTATTTCC ATGTATTGGCTTACTTCCCTCACGCTCCTGAGTAGGAACTGTGATGGACTGTCGCTTCTC AAATCTGCTACCTCCACTAGGAGGGGTAACCTTAAGGGATATACGAGGTCCAAGGATCTCATCTTTACTCCTTTTCTCTT CCAGTTG TAGAGTAGAAAGCCCTCTGCTTTTTCTTGTTCCTTTTCTCCCACGGTTAATCCGGTCTCATCTACAGCGACT ACGTTGATCTCTCCCTTTACTTCTCTGTAGATTGGGTAGAACTTGAAGGTTCTCTGACCTTTACTAATTACTTTCTCGCC TCGTCTTACTACCTTCAAGTAGTATTTTCCTCTGTTTCCGGTTAGCAAGGATGGTGCTGCTTTCACTATTTCCGGGTCTA GATCTTGAGAGATAACGTTAATATTGTTTGTTGCTAAATTTATAGCGAGGGACTTCAGCTCCGTTTTGGATACTTGTATG GTTTGCATAACGGAGTTATGGAGTCCCTCGCTTTAACCTTTTCTTGTTCATCTCGTCCTTCCACCTACTTTCCTCTATTG ATAATACTAGACAAATGGTATTACTCTTTATATATAAACTCGTTTTCTGTTAGTTTCTTCAACAAATATGAAAATTTTTT GCTTCTTGTGTTGAAATAAGCCGATTTT