SSO9898

Coordinates:1979839-1979982

>SSO9898 48 aa !not a gene!
MIREFPKTTKSIWHILKGRVIRLLHHRKRISNVSILYKSFLLYSYNHI

>SSO9898 48 aa !not a gene!
ATGATAAGGGAATTTCCTAAAACTACTAAAAGTATTTGGCATATCCTAAAGGGTCGGGTAATTCGTCTCCTTCATCATAG
GAAAAGAATATCAAATGTTTCTATTCTATATAAATCTTTTTTACTATACTCGTATAACCATATA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1979339 - 1980482 (Additional range around SSO9898 is :500nt.)

>Sulfolobus solfataricus P2 AAATACCGGAAAAGGATCCGCTCTTCACGTTGACTCTACTCTCATCTTGAGAGAATTCAATCTCTTTTCCGTTTACCTTG GCCTTTACTATCTTCAAACCTACAGCGTCCAGTACTACTGTTTCTTCATCGCTTTCCATTTCGATTTTCTCATATCCCTT ATAATCTCCAGTTTGAAAGCTAAAATCAAGAAAAATCTCGTATCTATTAACCTTAATCATGTGTTTTTATGATATAATAA GGTTTAAAGTGTTTTCTATTAACTCGAAATATCGTTATCAAGGGTGGATTTTAGGGGGTTCAAAGGACATATATACGAAC CTCTTAGTTTTGGTAAAAAAGTATAGCGTTTATAGGAAAATCGTTACACTTTTACGTTACATTAAAAATATATAACGAAT CTTTCCTGGTTAGATGAGAAATGTTTATTGATAAGCTATAATATTAAGAAGTGCAATGAAAGATATTTATAAATACATGG ATAAATATTTTGACTTTTT ATGATAAGGGAATTTCCTAAAACTACTAAAAGTATTTGGCATATCCTAAAGGGTCGGGTA ATTCGTCTCCTTCATCATAGGAAAAGAATATCAAATGTTTCTATTCTATATAAATCTTTTTTACTATACTCGTATAACCA TATA TAAAAATAAGTATAAAAAATCTATATAAAACAGTCTAATTTATATTCAGCCAAGACTGAATAACATATAGCACTT TACGGTTTTCTCCTCCTCTTGAACAGTTTTTTGATCCCACCCGCCTCACGGTAAATACTTTTTATCAATCTGGCCAACCT TTTGGCCCCGAGCATCAGACCCGTGGAGTACTTGAAGTATTGAACAACGAGGAGGGAGAGAGCCTTCAAGGCCACGAAGC CTGAGTTCCTAACCCAGGTCAAGAAGGACCCACCCTCGAGTCCCAAGGCCTTGAGCTCCCTGATCAAGACCTCTATGTCC CAACGGTTCTCCCAGGTCGTTATGATATCTTCAGCCGTGTCGTTAAGGTCGGTGGAGAAGAAATACCTCCTCCCGTAACC CTTATAGTCATCTATAACAAGTAACTTTATGGGAGTCCCCAAGTACTCTACCAGGTACTCCCCTTGGGGGAACTCGCTAA CGGGCACGGATCTGCCACCCTCGAC