SSO9900

Coordinates:1980253-1980435

>SSO9900 61 aa !not a gene!
MREFNLFSVYLGLYYLQTYSVQYYCFFIAFHFDFLISLIISSLKAKIKKNLVSINLNHVFL

>SSO9900 61 aa !not a gene!
TTGAGAGAATTCAATCTCTTTTCCGTTTACCTTGGCCTTTACTATCTTCAAACCTACAGCGTCCAGTACTACTGTTTCTT
CATCGCTTTCCATTTCGATTTTCTCATATCCCTTATAATCTCCAGTTTGAAAGCTAAAATCAAGAAAAATCTCGTATCTA
TTAACCTTAATCATGTGTTTTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1979753 - 1980935 (Additional range around SSO9900 is :500nt.)

>Sulfolobus solfataricus P2 GCAATTGGTAGGGAATTTCAAAATACTTTTCATAGAACTCTATAGAATTTCTTGAGATCTGCATAGAGAATCTTCCCTTT TGTACTTTGCCCGGTATTGTGGCTACTATAATTGTCGGGATTTTACCTTCATCCCTAATTTCTTCAAAGTTTCCAATTCC TAGGTATAGTAAATAGGTAGACATTTTAGGCGTTTCATCAAATTCATATACTACTTTCCCATTCTCTTCCTTTTCTCTCA CTACTGGCATATTGGATATTACCTTAAGTCCTTTATCAACTCTAACAGTTAACTTAAACCTGGCCTTCATTGCAGGATGA TCGAAACAAGGTATAAAGTCCCTAGCATGTGTAGCCTCAAACTGCGTACTAATAACGTATCCGTCTTTATAAGAGGCCTT ATAAATACCCACCAACTTCCTTTCAGTAACCTTTCCCTCAAATTCCACTTCTAAAATACCGGAAAAGGATCCGCTCTTCA CGTTGACTCTACTCTCATC TTGAGAGAATTCAATCTCTTTTCCGTTTACCTTGGCCTTTACTATCTTCAAACCTACAGC GTCCAGTACTACTGTTTCTTCATCGCTTTCCATTTCGATTTTCTCATATCCCTTATAATCTCCAGTTTGAAAGCTAAAAT CAAGAAAAATCTCGTATCTATTAACCTTAATCATGTGTTTTTA TGATATAATAAGGTTTAAAGTGTTTTCTATTAACTC GAAATATCGTTATCAAGGGTGGATTTTAGGGGGTTCAAAGGACATATATACGAACCTCTTAGTTTTGGTAAAAAAGTATA GCGTTTATAGGAAAATCGTTACACTTTTACGTTACATTAAAAATATATAACGAATCTTTCCTGGTTAGATGAGAAATGTT TATTGATAAGCTATAATATTAAGAAGTGCAATGAAAGATATTTATAAATACATGGATAAATATTTTGACTTTTTATGATA AGGGAATTTCCTAAAACTACTAAAAGTATTTGGCATATCCTAAAGGGTCGGGTAATTCGTCTCCTTCATCATAGGAAAAG AATATCAAATGTTTCTATTCTATATAAATCTTTTTTACTATACTCGTATAACCATATATAAAAATAAGTATAAAAAATCT ATATAAAACAGTCTAATTTATATTCAGCCAAGACTGAATAACATATAGCACTTTACGGTTTTCT