SSO9905

Coordinates:1982451-1982636

>SSO9905 62 aa !not a gene!
MLKNLYYFNLEYALSNSNPVPIPLSASGILRLLKNCSVSLSAPIPINGITSASLLPSIPVPL

>SSO9905 62 aa !not a gene!
ATGTTAAAAAACCTTTATTACTTTAACCTTGAATACGCTTTAAGTAACTCTAACCCTGTCCCTATTCCCCTCTCCGCTTC
TGGCATATTAAGATTACTAAAGAACTGCTCAGTTTCTCTTTCCGCCCCTATTCCTATTAACGGAATAACCTCCGCAAGTC
TTCTCCCAAGTATTCCAGTACCCTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1981951 - 1983136 (Additional range around SSO9905 is :500nt.)

>Sulfolobus solfataricus P2 CTCTTTAACAGTCCTTATACCCTCCACAGTATTCTTCTTTTTAGCCGAATGAGGAACCCCAGCGGGACCTAAATAAATCT TTGCCATCAATTTAAACTTGTTATACAAAAACGTATTTAAGCATCAACTGACATTGCGAAGTGTTTTTTCTCGTCCTCTA AAATTCTCATTATATCCTCGTCGTCCTCATTGAAGTTATTCTTGTAAAAATCAATAGCGTTTCTTTCCACAATTTCATTA ACCTTCTTAACTGCCTCTATTCCAAATAGCGAGATTATAAAACCCAATATTGAAAAAACATAATATACTGGTTTCTCTAG GAAAGACCTCCTATACTTCTGAAAATACTTCCAGTGATACATCTCATTTGAGTAGGACTCACGAAATATCTTATATCTAA TTGAAAATCCCCTATCTAATCCGGCTGCACCAGCTTCGCCTAATAGAGCTAGTTTATACTTATCCATAATGTATAATACC GTTAAAAGTTAAAAGGTAG ATGTTAAAAAACCTTTATTACTTTAACCTTGAATACGCTTTAAGTAACTCTAACCCTGTC CCTATTCCCCTCTCCGCTTCTGGCATATTAAGATTACTAAAGAACTGCTCAGTTTCTCTTTCCGCCCCTATTCCTATTAA CGGAATAACCTCCGCAAGTCTTCTCCCAAGTATTCCAGTACCCTTA TAGGCCTCTCTCATGAAGTTAATATGCATCTTA ATCCAGTTTAGTACTGCACTCTTAGCGTAAGGATTGTAAGCAGCTGTGCTTAAAGTTAAAGGAATATCTTGCTTCTTAAT CTCACCACTCAGTATTAAGCTTAAAGTGTTACCCACGAGGTAAGGCTTCCTGAAGAATAACATAGCAGTTAAATATCTAA GCTTCTCTTCATCAAAGGTTTCCTTCCTAAACCTCTCTAACAACTCGTCAACGGAATTGTCTTCATAGGTTATAGCATAT GCTACAGCTACTCCTTGTCTAGTATCAGAATCTAGAGAGCCATAGAATCTGAATAGCTCTGAAAGGCCTAAAGAGAACTC ATCATCTATTGCAGCAAGTCTATAGAGAATATTTGAGTACGTTAATCTTCCTAATTCATCCTTTGAATTTCTCCAATTCT TTAGCTGAATTCTATGAAATTCCTTTGCAATACCTTGATATTTATCTGGATTTATTGCATGAAGTGT