SSO9914

Coordinates:1987220-1987381

>SSO9914 54 aa !not a gene!
MGSIIFLYSSTPEVENAAVSAIKLTWELREDNILEISSFLIYSLLFSSSWKDAT

>SSO9914 54 aa !not a gene!
ATGGGTTCAATAATCTTCTTATACTCGTCAACACCTGAAGTGGAAAATGCTGCTGTATCAGCTATTAAATTAACTTGGGA
ATTAAGAGAAGATAATATACTGGAAATTAGTTCTTTCCTTATATATTCCTTACTATTCTCATCTAGTTGGAAAGATGCTA
CT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1986720 - 1987881 (Additional range around SSO9914 is :500nt.)

>Sulfolobus solfataricus P2 TTATAACCTTGGAGGGATTATCCACAACTATAATTTCATTGCCTTTACCACCAAGAAATTTGGCAATTGCTTTAGCAACT TCTCCTTCATCAGTAACTGCAATTTTCAATATCTATAATTCTTACTACCTAGAATTAAAAAGTTTCGATTACTATATATC ATTATACGAGTACGTTAAAAAATTGCTCTAGCTCAAGATTTTGCTTATCTCAGTTGTAATAACAGTTTTCAGTCGATCAA TGTTATCCCTTAATAGCTGTATGACAGCAGAGATCACTACATTCTCATCATATTCCTCTGTTACCTTACTTTTCAGTAAT GAGGCAAACGGCTGTATAATCTTATCTAATTCAATTGCTGACAAAGTATTGGATATTTCTTTTATATACTCAGCCAGTAT AATGGCCTTATCTATTGAAGACTCTGAAGATTTTTGCCTTATATTACCAGATAATTTAGATGCAATTATCTTACCTATAT TGTCCACTACTTGAACTATA ATGGGTTCAATAATCTTCTTATACTCGTCAACACCTGAAGTGGAAAATGCTGCTGTATC AGCTATTAAATTAACTTGGGAATTAAGAGAAGATAATATACTGGAAATTAGTTCTTTCCTTATATATTCCTTACTATTCT CATCTAGTTGGAAAGATGCTACT TGATATTGCACGCTTTGTATCCCTAATTTCTCTGCCAGGAATTCTATTAACGTCAC GGCATTTATCCCAACACTTCTGAACTTAGCAGCAGCCAATGGACATAGTGTAACTACTTTTCCATATCTCTCTCCTATAG CTCTAGCCATTAAGTCAGCTCTCTTTCCTAAACTCTTTTCTAGGATTGCACCTGAACAACCCTCAACCTTTTTAACCCTG AATCCTTTCTCGCTTAACCTTCTAATTACCTCATCTGAATATTCCGAGGAGAAACAAGCTACATGTAAATTTACATTTTC ATTACTTCCATCAATGACTATAGACTTTAGCAGTCTAAGTTCTAACGGTACTACTTCGAAAATTACCTCTGTTCCAGCCA ATTTAGAGTAGTCCTTATACGCTGTGGAGAATGTTCTATAATCCTCAGGAGTAATAGTAATTATTTCTAACGCATTATTA ACTGCATCTAAATTATATTTCATTTTCTCTAAGAATTTATTCC