SSO9923

Coordinates:1990234-1990371

>SSO9923 46 aa !not a gene!
MCSRYYQSMSRCNRKFIQKCDYSIVTIHDIPMIPSFNNVAKDTHLY

>SSO9923 46 aa !not a gene!
ATGTGTTCTAGGTACTACCAAAGTATGTCCAGGTGTAATAGGAAATTTATCCAGAAATGCGACTACTCTATCGTTACTAT
ACACGATATACCCATGATCCCTTCCTTCAACAATGTTGCAAAAGATACACATCTGTAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1989734 - 1990871 (Additional range around SSO9923 is :500nt.)

>Sulfolobus solfataricus P2 ATAATATCTTCCACCGACCTAGGATAAGCAACGTAGTCTGGGACAATGTTAATCTTTATTCCAGACCACACTAGTTCTGG AACGAAACCGAAATCCACTGAATGAGATAGTCTCTCTACTAATTCATCATGAAAACTATCCCCTAGTAAACTTTTCAACT CCTCTTCCAAACCCATATTACTACCCTTAAATGTTATATATTATTCTAGCATTTATATATTCTTTAAAGTTTCTATTATT GCTTTTTGTACGTACTCGTAATATTCCCTTGACTGTTCTTTTCTTGGTACGAAATCTTTCATTATATCTGGATCTTGGGA CCATGTTGGAACTATATGAAAATGAGAGTGAAATACCACTTGCCCTGCACTCTTTCCAATATTGGTTAATATTCTTATAC CATCAGCCTTCAAAGCTTTCTTTACTGCAATTGAAATCTTTCTTACAGCTGTACATAAATATGGTATGACGTCTTCAGAA ATCTCTAAAAAATTCTCATA ATGTGTTCTAGGTACTACCAAAGTATGTCCAGGTGTAATAGGAAATTTATCCAGAAATG CGACTACTCTATCGTTACTATACACGATATACCCATGATCCCTTCCTTCAACAATGTTGCAAAAGATACACATCTGTAT TGACCCTCATTACTACAAAATTATAAGTTTAGTTACAAAAAATCCCTTTGCTATTCAACTGGATTTCTTCATTCATGAAG ATTCCATTTTTAATATTAAGTTTTGTGTAGGGAAGTCAAATTATGAAACATCACTGCTTTTAAGCTTATTATCAAGGGTC TTCTATGCAGACTTCTTTTCCTTTCTTAAACTCTATGTGTAATATTTTTTGTAATTCTCTTCCTAAAAGCGAAATTTCCC TACCAAGAATAGGACTTTCAATAAGAGTGTCAAGTTTAATTTTACCAATCTTTATAATAGCCTTAGCAACTCTAGTTTTA ACAATTCCGTTAAGCGTTGCGTAAACTCTTGGATTCTCTAGCTCAAGGGAATTTACTTTATTGTAAACAGAAGGAGGGAT TAAAAGATAACCGGAAAATCCAGTGTCAATTAATGCTCTAACTTCCATGAAATCCCCATTATAAGGATCTATTACGGTAA CCGGTAAAGTAGGTTTATC