SSO9928

Coordinates:1991501-1991644

>SSO9928 48 aa !not a gene!
MGTTSYSVFDPLLFSRGFTASLLNGVLSPRSAWAYVNISLICLFPFLL

>SSO9928 48 aa !not a gene!
TTGGGTACAACCTCCTACTCGGTGTTTGATCCTCTCTTGTTTTCTAGAGGTTTTACAGCTAGCCTCTTGAATGGGGTTTT
ATCCCCTCGGAGTGCCTGGGCTTATGTTAATATTTCTCTTATTTGCTTATTTCCTTTTCTCTTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1991001 - 1992144 (Additional range around SSO9928 is :500nt.)

>Sulfolobus solfataricus P2 CTATAGGATAGCGTTATTACTTTTAAACATTATGCAAGGAAGTTTGTAAATATGAAAGTTTGGTTGCAAACTGATAAGGT TTCAGGTAAGATCGTAGCAATTAGAATCGATGGTAAGATGACGTATAGATATAATCCAGAATACATACCCTATGGAGTTA AAAATATAACAATAGAAATAAACGATTTTACCCCTATAAAGGGTGATCATATAATAGAATTGATAACTGAAAAAGGCGAT TATATTAAAGCCAAGTTTAGTATCTGACTAGTTTTAATTTTACAAAAAGCCTCAAGATAAATTCGAAATATATCTATTTG CTTTTTTAACGCTTTGAAGTCTACTTGATGTATCAAGAGGCCCTACAAGCTTCACCTCTAACAGAGCTGGGGGAATTGAG AATCTATGGGTGTCAATCATGTACCCCTATATATTCCTTGTGGTCATAACACCTTGTTTTTCTTGCATAATATTAACTAT GTTCAGCCCCTAGAGTAGT TTGGGTACAACCTCCTACTCGGTGTTTGATCCTCTCTTGTTTTCTAGAGGTTTTACAGCT AGCCTCTTGAATGGGGTTTTATCCCCTCGGAGTGCCTGGGCTTATGTTAATATTTCTCTTATTTGCTTATTTCCTTTTCT CTTA TAATACTTGGTTTTATTCGTTCTCTAGTTTCGCGTTGATTCCCCGTGGAAGTGAGTTCTCCCTCTCCTTGGAGTC TGAGTTGAATAATTACCTTAATATAGATATATTCTTATTTACTTTTATAATTCCGTTTATCCTTATGTCAAGTTATTATA TAGATAGTGAGTTTTAATCTATCGAGAAGGGACGAGGCTTATCGTTCTTTTTGTCAGACTCATGTATTAAAGATAAACTT TATTATATTTCTTACCAAGTTAAACATATGGCAACAAAGGTGCTGATAAAGAATATGGACGAGCAGCTTTATAGGATGTT AAAAGCTAGAGCTGCACTATTAGGGATAAGTGTCTCTGAAGCAATACAGCAGGCTATTTCTTTGTGGCTCAACGTTACCG AAGGAATAGGTGATTATAATTACATCGTACTTAAGACTAATCCTGAAGCAATAAATGCATATAATGAAGGAAAGTATGTT TTAGCTTGTGACGGAGAATATATAG