SSO9946

Coordinates:1996887-1997042

>SSO9946 52 aa !not a gene!
MTILSGNPKHFPSILTCVLYKSPIGKTSTPPSPYFVKYPNSSSLLSPVPTTK

>SSO9946 52 aa !not a gene!
GTGACTATTCTTTCCGGTAACCCTAAACATTTTCCTAGCATTCTAACCTGTGTCTTGTACAAATCACCTATTGGTAAAAC
ATCAACACCTCCATCCCCATACTTTGTGAAGTATCCTAATAGTAGCTCACTCTTGTCTCCAGTTCCTACCACCAAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1996387 - 1997542 (Additional range around SSO9946 is :500nt.)

>Sulfolobus solfataricus P2 TTGTTCCAAACACCACACACTTGTTAACTTTCTCTGCTATTTTCTGTGTAGCCTCCTCTGCGTCTTTGTATATTTCATAT GTTAAGTCCTTTATAATGTAACCAGTTAAGGACAGTTCTGGAAAGATTACACAATCTGCGCTACTGCTCTCTATTATTTC TAAATGTTTCTTGTAGTTCCTATAGACGTCCCCGGGATAAGATCTTATTTGGGCTAATTCCACTTTTATGCCCATCTTCT AGGGAACCTCCAGTCTGAGTTTATTGCCCTTCCACTTAACCTAAAGATCTCTGGGGGTAGCCTCTTGTGTTGAGAGATTT TAACTAGTCTATCAACTTTTTTAACAATATCTATAGGAATTCCCAACATTTTCACTATCTCGTCTTCGCTTCTCATTTCA TCGAATCTTAAATATAGTATTGAATCTATTGTTTCATAGTCAATTCCTAATTCTCCTTCTGCTGTTTGTCCTTCCCATAA GGCTGGGGAACTTGGTTTT GTGACTATTCTTTCCGGTAACCCTAAACATTTTCCTAGCATTCTAACCTGTGTCTTGTAC AAATCACCTATTGGTAAAACATCAACACCTCCATCCCCATACTTTGTGAAGTATCCTAATAGTAGCTCACTCTTGTCTCC AGTTCCTACCACCAAG TAATCTAACATTTGCGCATAAGCGTAAAGTATTATCATTCTAACTCTAGCTTTTATGTTGCCT ATTATATATTTATTTTCTGTTTCTATTTTATTTGAAAATGACTTCACAATTTCATCTATATTAATTAATTTGTATTTATT TTGTGCATTAAGGAATTTTATCATTTCGAATGAATCATCCAAATCTATCTTTGGCGTTGAAGAGGAAGGCATGAGAAGTA TGAAGAAATTATCAGTAGCTTTAGCAAGAAGCGTTGCAGTTACCGCTGAATCCACTCCCCCGCTTACCCCTATTACTCCT CCTTTCTTATTGCTAAATTCAAGATACTCCCTTATCCTTTCCACAATATAGTTAGTAACAGCTTCACAATCTATTGTGAG TGATTTTCTGATATATTCATGCATTACCATTATGAGAATATTTGTTGAGCAAATATTTAACGTATAATACCATCTGAATG AAGAGAATTTAGAAAAGGCCATAGAAGAAGTTAATCT