tg0006

Coordinates:7457-8194

>tg0006 hypothetical protein TGAM_0006
MKILLSFPHVQTLVEMGKVSGIFLTALGTVLWYAGGSSGNQAMVNLGIGSIILGIVAFSLPGWKCLPPEAGEVLGGGHCA
LFSNLASDLGLRGKAFVLPPYENLPRGGIFIPVSPRGSPNLGRLFEGRVLYSEPEPGLLLSPVPGWRFIDGLKLLGSGVG
YAASAVSGVLDRFGLPGAKVFEEDDTVEVYVKASCKEFPYADPVVSAVLVALASGAGEVLVVEEVGEVKGHLKLLLRKAG
GVEKWL

>tg0006 hypothetical protein TGAM_0006
atgaaaatccttttaagttttcctcacgttcaaactctggtcgaaatggggaaggtaagcggcattttcctgacggctct
cggtacggtcctctggtacgccggtggttcgtctggaaatcaggcgatggtaaacctcgggataggttcaataatactcg
gcatagttgccttctccctccccggctggaagtgcctccctcccgaggcaggggaagttctgggaggcggccattgcgct
ctcttttcaaaccttgcatctgaccttgggctcaggggaaaggcgttcgtccttccaccctatgagaacctcccccgggg
gggtatattcatccccgtgtcccccaggggtagccccaacctcggcaggctctttgaggggagggttctctattccgagc
ccgagccgggtttgctactctcaccggttccggggtggagattcattgacggtctgaaactcctcggctcgggggtcggt
tacgccgcctcggccgtttcgggcgttctggacaggtttggccttcccggtgccaaagtttttgaggaagatgatactgt
ggaagtttacgttaaagcctcctgtaaggagttcccctacgccgatccggttgtttccgccgttttggttgccctggcat
cgggtgccggtgaggtcctcgtcgttgaggaggtgggggaggttaagggccatcttaagctcctcctgagaaaggccggc
ggtgttgagaaatggctg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 6957 - 8694 (Additional range around tg0006 is :500nt.)

>Thermococcus gammatolerans EJ3 GTGTCGAACCTTAGTATTTTCGTCTCGTTGTAGAGCTCTATCGCTTTTATCTCCCCGAGATATATCTTCATTCTCTCTAT CGTGTTGACTATTCCGGTTGCGAGGGCTATGCTCCCGTTGTCCTCCTGGAACTTGAACAAAAGCTTGTCCAGTGTTATCA GATCAACGGAGAAGTTGTAGAAGGGAGGAAGGATGTCAAAGACTCTCGCCTTTATCCTCTTCTCCCGATAGATCCTGCTT TCCCTCATTATCCGAAGGAGGTCGTTATGCGTGTTCTCGGCCAGGGTCAGGCCGTAGTCGTTTCCCTCGTAGGCGTACTT CAGGGAGTACGCGAACTTTTCGAGGGTGTGGGAAAAATACTCGTAGAGAAACTCGTCGTGGGGGGCCGGCTTCTCAACTC CCCTTGCTCCCGCGGGGGGAAGCATCAGGAGCAGGATTGTGATTATCGTTAGGAGTTTTACCAGTTTTTCTAACCTCATG TTGGCCCCCCATTATGGTC atgaaaatccttttaagttttcctcacgttcaaactctggtcgaaatggggaaggtaagc ggcattttcctgacggctctcggtacggtcctctggtacgccggtggttcgtctggaaatcaggcgatggtaaacctcgg gataggttcaataatactcggcatagttgccttctccctccccggctggaagtgcctccctcccgaggcaggggaagttc tgggaggcggccattgcgctctcttttcaaaccttgcatctgaccttgggctcaggggaaaggcgttcgtccttccaccc tatgagaacctcccccgggggggtatattcatccccgtgtcccccaggggtagccccaacctcggcaggctctttgaggg gagggttctctattccgagcccgagccgggtttgctactctcaccggttccggggtggagattcattgacggtctgaaac tcctcggctcgggggtcggttacgccgcctcggccgtttcgggcgttctggacaggtttggccttcccggtgccaaagtt tttgaggaagatgatactgtggaagtttacgttaaagcctcctgtaaggagttcccctacgccgatccggttgtttccgc cgttttggttgccctggcatcgggtgccggtgaggtcctcgtcgttgaggaggtgggggaggttaagggccatcttaagc tcctcctgagaaaggccggcggtgttgagaaatggctg TGAGGGATTATCTGATAATTTTTCTCGGCCTCTGGATAGTC CTGTCGGCGGTTCTCTCACCATCCACCGAGGTCTTCCTCACGGTGGTTCTTATCGGACTGCTGATAACCTTGGAAATTGG GGAGTTCTACCTCTCCGAGGAGACGAAGGACGGTCTTAAGTACTCCTCTTATTTCCTTCTCCTGGTGTTTGCGGTCATCG TGGCAATGAAGGTGTATGAAATTCTGAAGTGATCCCCTGAGCGAGCGGCAGAAGATTGCAAGAGGGACGGGAATTGTCTT TTCTGGAACGGTTGTCTCAATATTCTTCGGGTTTTTGAGCAGGGAGATTATAGCGAGGTACTTTTCCACCGTAGATCTTG CCGTCTCCATAGAAAATTTTGCATCTTTCATCTTGATTCCCTGATTTCTGGAATTGGTAAGAACCTGCAACAATTCCAGG ATCCTCGAGTGGAGGTTTTCATCCAACCTAAGTTCTACCATCCCTATGGAACTGGGGAG